KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236506Help
Entry
112236506         CDS       T05605                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03030  DNA replication
otw03410  Base excision repair
otw03420  Nucleotide excision repair
otw03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    112236506 (lig1)
   03410 Base excision repair
    112236506 (lig1)
   03420 Nucleotide excision repair
    112236506 (lig1)
   03430 Mismatch repair
    112236506 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112236506 (lig1)
   03400 DNA repair and recombination proteins [BR:otw03400]
    112236506 (lig1)
Enzymes [BR:otw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     112236506 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     112236506 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     112236506 (lig1)
DNA replication proteins [BR:otw03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    112236506 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     112236506 (lig1)
DNA repair and recombination proteins [BR:otw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     112236506 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     112236506 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     112236506 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 112236506
NCBI-ProteinID: XP_024260867
LinkDB All DBs
Position
Unknown
AA seq 1102 aa AA seqDB search
MQRSISSFFQPKTGKEKESKKSDGPGKDEPVKDKPEPIKRPLKVQNGVHEEPDSPVKKFT
KRSRQILDSDDEAPAGIEQEPEDKAVQPKDEVFKAVTNPLSPASPVTSSASPTPGTPDTP
TSISPSGIPKRRTARKQFPKRKLDSRSGSEKEEEEQGQQNKRAKVEETQDSTENEEEAMD
VGGENSVDKPEVAQNNPEEKETDEEKTKDGEKEKALDVKVTATEEEKGKSEKAKERSPTE
RSQKVKERSPTERSQKVKERSPKERSQKVKERSPKERSQKVKERSPKGQKVKERSPKERS
PKERSPKGHKAVKVGKDMKEEKVSESPQAKKAPTISSFFAPRKAAVKMERPEKSEGKEKS
EGEGEEKSEGYIKEEATGSRTTEDVKDKKGEKTAQAQYDPSRPNYHPVDHACWSRGQRVP
YLAVARTFEKIEEDSGRLRNIETLSNLLRSVIILSPEDLLCCVYLCLNQLGPAYMGLELG
VGETVLMKAVAQATGRQLDKIKAEAAEKGDLGLVAESSRNNQRIMFQPANLIAGGVFNKL
KDIGNMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLSALSQAVC
LSPPGQDFPPAVIDAGKGMSAEKQKAWIEEKSLLLKQTYCEMPNYDVIIPVILKEGIDEL
PNHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHILENGEVRIFS
RNQEDNTTKYPDIISRIHTVKNESVISCVLDTEAVAWDREKKQIQPFQVLITRKRKVTGK
KLWVSFSLWVSLCVYLHCLCSTGCPILSLDTADFCLMDMGVYQCLICFQILCGSMENMSL
MWSRSLWVSLWVCQSLVKQPLSCRRALLKKSFQEKEGEFVFARAIDSDNTDAIAEFLEQS
VRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLDGVGDTMDLCVIGAYLGKGKRAGT
YGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQHYKFLKEHILPKPRPYYRVDQSTEPDL
WLDAVQVWEVKCADLSLSPIYKAGMGLCDPEKGISLRFPRFLRIRDDKKPEEATSGGQIA
DLYRKQQVVQKQGDKADLEDYY
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatatcatctttctttcagcccaaaacgggcaaagagaaggagagcaaa
aaaagtgatggaccggggaaagacgagccggtgaaagacaagccagaaccaatcaaaagg
cctctcaaagttcagaatggtgtccatgaggagcctgattcgcccgtgaagaagttcact
aaacgcagtcgtcagatcttggacagtgatgatgaggctccagccggaatagaacaggag
ccagaggacaaggctgtgcaacccaaggatgaagtattcaaggctgttaccaaccccctg
tcccccgcctctccagtgacctcatccgcctcccccacccctggaacccctgacaccccc
acttccatctcaccctcgggaatacccaaacgccgcaccgcaaggaagcagttccccaag
agaaagctggacagcaggagtggcagtgaaaaggaggaggaagaacaaggacagcagaat
aaaagggcaaaggttgaggagacgcaggacagcaccgagaatgaagaggaagcgatggac
gtgggaggagagaacagtgtggataagcctgaggtggcgcagaacaacccggaggagaaa
gagactgatgaagagaagaccaaagatggagagaaggagaaagcacttgatgtgaaagtg
accgcgaccgaggaggaaaaaggaaaaagtgaaaaggctaaagagagaagtcctacagag
agaagtcaaaaggttaaagagagaagtcctacagagagaagtcaaaaggttaaagagaga
agtcctaaagagagaagtcaaaaggttaaagagagaagtcctaaagagagaagtcaaaag
gttaaagagagaagtcctaagggtcaaaaggttaaagagagaagtcctaaagagagaagt
cctaaagagagaagtcctaagggtcacaaggcggtaaaggttgggaaagacatgaaagaa
gagaaggtgtcagaaagcccccaagccaaaaaagcccccaccatcagcagtttctttgct
cccaggaaggctgctgtaaagatggagagaccagagaagagcgagggaaaggagaagagt
gagggagagggagaggagaagagtgagggttatataaaggaagaggctactggttcccgt
accacggaggacgttaaagacaagaaaggagagaagactgcccaggcccagtatgacccg
tccagacccaactaccaccctgtagaccacgcctgctggagccggggacagagggtcccg
tatttggctgttgcacgcacctttgaaaagattgaggaagattctggcagattgaggaac
attgaaacattatcaaatctcctacgctctgttatcatcctctctccagaggacctgctg
tgctgcgtctacctgtgtctcaatcagctgggtcctgcttacatggggctggagctggga
gtgggagaaactgttctgatgaaggctgtcgcccaagctactgggcgacagttggacaaa
atcaaggcggaggctgcagagaagggggacttggggttggtggctgagagttcccgtaac
aaccagagaattatgttccagccagccaatctaattgcagggggtgtgttcaacaaactg
aaagacatcgggaacatgagtgggaattctgccatgaataagaagattgacatcatcaaa
ggtctctttgtagcctgtcgtttctctgaggccagatacattgtcaggtcgctggcaggg
aagctgaggattggcttggctgaacagagtgtactgtctgccctgagtcaggccgtgtgt
ctgtctcctccaggacaagacttccctccggcggtgattgacgcagggaaaggaatgagt
gcagaaaaacagaaagcttggatagaagagaagagccttctcctcaaacagacttactgt
gagatgcccaactatgatgtcatcatcccagtcattctgaaggaggggattgatgaactc
cccaaccactgcaaactcactccaggtgtaccattgaggcccatgctggctcaccccacc
aaaggtgtaggagaggtgatgaagagatttgatgaagccgccttcacctgcgagtacaag
tatgatggagaacgagcacagatccatatcttggagaacggggaagtgcgtattttcagt
cgtaaccaggaggataataccaccaaatatcctgacatcatctctcgcattcatacggta
aagaatgagtctgtgatatcctgtgtgttggacactgaggcagtagcttgggacagagag
aagaaacagatccaaccattccaggttctcatcacacggaagagaaaggtgacaggaaag
aaactctgggtctctttctctctctgggtctctctctgtgtatatttacattgtttgtgc
tccactggttgtcctattctaagtcttgacactgcagatttttgcctaatggatatggga
gtttatcaatgtttgatttgttttcaaattctttgtggatctatggaaaatatgtctcta
atgtggtctcgctctctctgggtttctctctgggtgtgtcagtctctagtgaagcagccc
ttgtcatgtcgcagggctctgttgaagaagagcttccaggagaaggagggagagtttgtg
ttcgcccgcgccatcgactcagacaacacagacgccatagctgagttcctggagcaatcg
gttcgagactcctgtgagggactcatggtgaagactctggagaaagatgccacgtatgaa
atcgccaagcgctctcacaactggctcaagctgaagaaggattatctggatggcgtgggg
gacacgatggatctgtgtgtgatcggagcgtatctggggaagggcaagagagcagggacc
tacggaggctttctgctcgcctgctacgatgaggacaatgaagagttccagtccgtctgc
aagattgggacaggtttcaaggatgaagatttggagcaacattacaaattcttaaaggag
catattttgccaaagccccgcccctattaccgtgtggaccaatcaactgagcccgacttg
tggctcgatgccgtgcaagtatgggaagtgaagtgtgccgacctatcgctgtcgccgatc
tacaaggctggcatgggattgtgtgacccagagaagggcatctctcttcggttcccacgc
ttcctgaggatcagagatgataagaagccggaggaggccacttcaggaggacagattgct
gatttatacaggaagcagcaggttgttcagaaacagggtgacaaagctgacctcgaggac
tactactga

DBGET integrated database retrieval system