KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236527
Entry
112236527         CDS       T05605                                 

Gene name
il10
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-10
  KO
K05443  interleukin 10
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112236527 (il10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112236527 (il10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112236527 (il10)
   04672 Intestinal immune network for IgA production
    112236527 (il10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112236527 (il10)
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112236527 (il10)
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Interleukins
   112236527 (il10)
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Cytokines
   112236527 (il10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 112236527
NCBI-ProteinID: XP_024260885
LinkDB
Position
Unknown
AA seq 189 aa
MSPCSLLLSVLLAAALQCEHAQCRRVPCSDRCCSFVEGFPVRLKELRTAFSTIRDYYVSN
DELETPLLDKGIXTHQGILDHIKVPGGGHTMDSILSXLSHTVLPTAHEHNNGNTTLKSPI
DSIGNIFHEXKKKIVQCRNYFSCKKPFDINNLISSYKKMQDKGLYKAMGELDLLFNYIEE
YLVSQRRKH
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtctccctgctctctcctcctgtccgtgctgctggctgcagcgctgcagtgtgagcat
gcccagtgcagacgtgtaccgtgctccgaccgctgctgctccttcgtagagggcttcccc
gtcagactgaaggagctccgcaccgccttctccaccatcagagattactacgtaagtaat
gatgagctggaaacacctcttctcgacaaggggatctagacacatcaagggattctagac
cacatcaaggtacccggtgggggtcatactatggacagcatcctgagtnntctatctcac
acggtgttgcccaccgcccatgaacacaacaatggaaatacaactttaaaatctcccatc
gactccatcggaaacatcttccacgagntgaagaagaagatcgtccaatgtaggaactac
ttctcctgtaagaaaccgtttgacatcaacaacttaatctcctcatataaaaagatgcag
gataagggcctttataaggcaatgggagagctggacctgctcttcaactacatcgaggag
tacctggtctctcagagacgcaaacactaa

DBGET integrated database retrieval system