KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237092Help
Entry
112237092         CDS       T05605                                 

Definition
(RefSeq) uncharacterized protein LOC112237092
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00910  Nitrogen metabolism
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    112237092
Enzymes [BR:otw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     112237092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 112237092
NCBI-ProteinID: XP_024261475
LinkDB All DBs
Position
Unknown
AA seq 426 aa AA seqDB search
MHMVLFNSDKYPNISVAADKSDGLAVLGVLIEVGEFNPAFAQFLKYIDGIKYKDQRVQVP
AFNIRSLLPVLLDEYYRYDGSLTTPPCYPSVLWTVFKNPVTISLKQFLALATAIYSSHQQ
ESAPVAMNSNYRKPQYTDNRVVLCSFQGGRGLQGATQTVTSPFLRRQVINQLLDGDLADL
ADQDGLNQLLDGDLADQDGLNQLLDGDLADLVDQDGLNKLLPKKPRAPGKKGWTQSHIGS
KHYQNTGSQTQNSLQQQRSKPNKVPSGGTGAARLVPSPWKNQQNRQPVWKLGLSEDMLCY
VSLEQDVSRQLSRGRSPTHTDTQLVQALRETLFPELNLRSYLGCKSDLALFTIRQLLRGR
SATDEALELDQAIVKALGGTGQRGSTAQQQTKTLSKHQTGFAPAPAAVPKKPNQPIPWLQ
PMEWED
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcatatggtgctcttcaactcagacaagtaccccaacatctctgtggcagcagacaag
tcagacggcctggctgtactgggagttctgatagaggtcggggaattcaacccagcgttc
gcccagttcctcaagtacatcgatggtattaaatacaaagatcagagggtgcaggtccca
gccttcaacatccgcagtctgctgcctgtactcttggatgaatactaccgttatgatggc
tcgttgaccactcccccctgctatcccagcgtgctttggactgtgttcaaaaaccctgtc
accatctcactcaaacagtttctggccctagcaacggccatctactcctcccaccaacag
gagtcggccccagtggccatgaacagcaactacaggaaaccacagtacacggacaacaga
gttgtgctctgctctttccaggggggcagaggactacagggtgctactcagacggtcacc
tctccgttcctgaggaggcaggtcatcaaccagctgttagatggagacctggcagacctg
gcagaccaggatgggctcaaccagctgttagatggagatctggcagaccaggatgggctc
aaccagctgttagatggagatctggcagacctggtagaccaggatgggcttaacaagctg
ttgcccaagaagcccagagcaccgggcaagaaaggctggacccagagccatattgggtcc
aagcactaccagaacaccgggtctcagacccagaacagcctccagcagcagcggtcgaag
cccaataaggtgccatccggggggacaggagctgccagattagtcccatctccctggaag
aaccaacagaacaggcaacctgtgtggaagttaggtctgagcgaggacatgctgtgttac
gtctccttggagcaggatgtgtctcgccagctgagcagagggagatcccctacccataca
gacacccagctggtccaggctctcagagaaactctgttcccagagctcaacctgcgcagc
tacctgggctgtaagtctgacctggctctgttcaccatcagacagctcctccgggggaga
tcagccacagatgaggccctggagctggaccaggccattgtcaaggccttgggggggacg
gggcagagaggctccacagcacagcagcagaccaaaactctctccaagcaccaaacaggc
ttcgctcctgcccctgctgccgtgccgaagaaacccaatcagccaatcccatggctccag
cctatggagtgggaggactag

DBGET integrated database retrieval system