KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237814
Entry
112237814         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like isoform X1
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112237814
   04068 FoxO signaling pathway
    112237814
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112237814
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112237814
   04217 Necroptosis
    112237814
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112237814
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112237814
   04052 Cytokines and growth factors [BR:otw04052]
    112237814
   04090 CD molecules [BR:otw04090]
    112237814
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112237814
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112237814
CD molecules [BR:otw04090]
 Proteins
  112237814
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 112237814
NCBI-ProteinID: XP_024262182
LinkDB
Position
Unknown
AA seq 269 aa
MSGTQGYPYPQVFLVDSGRGPQPSVQPPGMLPCWSFPPAQERVMERGRGRGCRGVGSWSL
TMALLFLLLLVFGALGLGTYQIIKLQTQLDGIQQEINIEIDGRGPEKLVGDLPETDPNRG
KTAGRPAAHVIGRIEKHVSQNTLRWEPKAGRAFTEGGVVYRDGGLQVNETGLYHIYSRVQ
FEANHCTPTDALVHSVFVRRPGNRKSLTLMEGHREGYCNLGSHGHVWTSGSYLGSTLKLE
KQDWLYVNVSHPAMLSHAHHANFFGLHKI
NT seq 810 nt   +upstreamnt  +downstreamnt
atgagtggtacacagggctatccttacccccaggtgtttctagtggacagtggtagaggt
ccacagccgtcggtccaacctccaggcatgctgccctgctggtccttccctcctgcccaa
gagagagtgatggagcggggcaggggcagaggctgcaggggggttggctcctggagcctg
actatggctctgctgtttctgctgctgctggtgtttggggcattgggactgggtacctac
cagataatcaaactacagactcaactcgacgggatacaacaggaaattaacattgagatt
gatggtcgtgggcctgagaagctagtgggtgaccttccagagaccgatccaaacagaggg
aagacagccggcagacctgcagcacatgttataggccggattgagaagcatgtttcacag
aataccttgcgttgggagccaaaggcggggcgggccttcacagaggggggcgtggtctat
cgggatggcggtctgcaagtcaacgaaactgggctctaccacatctactcccgggtgcag
tttgaagccaatcactgcacccctacagatgccttggttcactctgtgtttgtaagaagg
ccagggaatcgcaagtctctcaccctaatggaggggcacagggagggctactgcaacctg
ggctctcatgggcatgtctggacctcggggagttacctgggatccacactgaagcttgaa
aagcaggactggctgtatgtgaatgtctcccatccagccatgctcagccacgctcatcat
gccaacttctttggactccacaagatctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248671
Entry
112248671         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like isoform X1
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112248671
   04068 FoxO signaling pathway
    112248671
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112248671
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112248671
   04217 Necroptosis
    112248671
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112248671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112248671
   04052 Cytokines and growth factors [BR:otw04052]
    112248671
   04090 CD molecules [BR:otw04090]
    112248671
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112248671
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112248671
CD molecules [BR:otw04090]
 Proteins
  112248671
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 112248671
NCBI-ProteinID: XP_024273663
LinkDB
Position
1
AA seq 269 aa
MSGTQGYPYPQVFLVDSGRGPQPSVQPPGMLPCWSFPPAQERVMERGRGRGCRGVGSWSL
TMALLFLLLLVFGALGLGTYQIIKLQTQLDGIQQEINIEIDGRGPEKLVGDLPETDPNRG
KTAGRPAAHVIGRIEKHVSQNTLRWEPKAGRAFTEGGVVYRDGGLQVNETGLYHIYSRVQ
FEANHCTPTDALVHSVFVRRPGNRKSLTLMEGHREGYCNLGSHGHVWTSGSYLGSTLKLE
KQDWLYVNVSHPAMLSHAHHANFFGLHKI
NT seq 810 nt   +upstreamnt  +downstreamnt
atgagtggtacacagggctatccttacccccaggtgtttctagtggacagtggtagaggt
ccacagccgtcggtccaacctccaggcatgctgccctgctggtccttccctcctgcccaa
gagagagtgatggagcggggcaggggcagaggctgcaggggggttggctcctggagcctg
actatggctctgctgtttctgctgctgctggtgtttggggcattgggactgggtacctac
cagataatcaaactacagactcaactcgacgggatacaacaggaaattaacattgagatt
gatggtcgtgggcctgagaagctagtgggtgaccttccagagaccgatccaaacagaggg
aagacagccggcagacctgcagcacatgttataggccggattgagaagcatgtttcacag
aataccttgcgttgggagccaaaggcggggcgggccttcacagaggggggcgtggtctat
cgggatggcggtctgcaagtcaacgaaactgggctctaccacatctactcccgggtgcag
tttgaagccaatcactgcacccctacagatgccttggttcactctgtgtttgtaagaagg
ccagggaatcgcaagtctctcaccctaatggaggggcacagggagggctactgcaacctg
ggctctcatgggcatgtctggacctcggggagttacctgggatccacactgaagcttgaa
aagcaggactggctgtatgtgaatgtctcccatccagccatgctcagccacgctcatcat
gccaacttctttggactccacaagatctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251074
Entry
112251074         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251074
   04068 FoxO signaling pathway
    112251074
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112251074
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112251074
   04217 Necroptosis
    112251074
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112251074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112251074
   04052 Cytokines and growth factors [BR:otw04052]
    112251074
   04090 CD molecules [BR:otw04090]
    112251074
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112251074
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112251074
CD molecules [BR:otw04090]
 Proteins
  112251074
SSDB
Motif
Pfam: TNF Sarcoglycan_1 Tad
Other DBs
NCBI-GeneID: 112251074
NCBI-ProteinID: XP_024277520
LinkDB
Position
5
AA seq 257 aa
MFLVDYSGGSQPSVQPPGLVPCWSFPPAQERVREQGRARGCRGVGSWSLVVALLFLLLLV
FGALGLGAYQIHKLQTQLDGIQQVNIESQGCAPEKLVGDLPESDPDTGKKASRPAAHVIG
RIEKDVSQNTLRWEPKAGRAFTEGGVVYRDGGLQVNETGLYHIYSRVQFEANHCTPTDAL
VHSVFVRRPWSSKPLTLIEAHREGYCSSGSNGRVWTSGSYLGSTLQLEKQDWVYVNVSHP
AMLSHTHHANFFGLHKI
NT seq 774 nt   +upstreamnt  +downstreamnt
atgtttctagtggactacagtggaggttcacagccgtcggtccaacctccaggcctggta
ccttgctggtccttccctcctgcccaggagagggtaagggagcagggcagggccagaggc
tgcaggggggttggctcctggagcctggttgtggctttgctgtttctgctactgctggtg
tttggggctctggggctgggagcctaccagatacacaagctacagactcaactggatggg
atacaacaggttaacattgagagccaaggttgtgcgcctgagaagctagtgggtgacctt
ccagagtctgatccagacacagggaagaaggccagcagacctgcagcacacgtcataggc
cggatcgagaaggatgtttcccagaataccttgcgttgggagcccaaggcagggcgggcc
ttcactgagggaggcgtggtctatcgggatggtggtctgcaggtcaacgagactgggctc
taccacatctactcccgggtgcaatttgaggccaatcactgcacccctacagatgccttg
gttcactctgtgtttgtgaggaggccctggagctccaagcctctcaccttgatagaggcg
cacagggagggctactgcagctcgggctctaatgggcgtgtctggacctctgggagttac
ctgggctccacattgcagctggagaagcaggactgggtctatgtgaacgtctcccaccca
gccatgctcagccacactcatcatgccaacttctttggactccacaagatctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263074
Entry
112263074         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112263074
   04068 FoxO signaling pathway
    112263074
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112263074
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112263074
   04217 Necroptosis
    112263074
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112263074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112263074
   04052 Cytokines and growth factors [BR:otw04052]
    112263074
   04090 CD molecules [BR:otw04090]
    112263074
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112263074
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112263074
CD molecules [BR:otw04090]
 Proteins
  112263074
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 112263074
NCBI-ProteinID: XP_024294831
LinkDB
Position
12
AA seq 250 aa
MTAAGNEEVRCEIRCHRAKSDRILYSRVSRRDKVLSVCLTRFATFVSILLSCAALLLHAY
QHKAADNRLTSAGSYSIGSLQQQQVRTNPSAHLTAPASFNNSKREYLEWEDKLGLAHLSD
FEYDDGDLIVPKDGVYEVYLQITFRRPSHFVCSKEGPVFILSQRVILFAMNYQNDRELLT
ASDTVYCSQPPGSKGCMEEDSVVPYWEKSPRTSGVFKLKAGDRLRVSNEDRYHELMLLQE
DKTFFGAHLI
NT seq 753 nt   +upstreamnt  +downstreamnt
atgacagccgctggcaatgaagaggttcgctgtgagatccggtgtcatcgtgcgaagagt
gacaggattctttattcccgggtgagccgcagagataaagtgctgtcagtgtgcctcact
cggtttgctacatttgtctctatacttctgtcgtgtgctgcactcctgctacacgcatat
caacataaagcagcggacaaccggctcacttcagcgggaagctattctataggcagtctt
cagcagcagcaagttagaaccaatccaagtgctcatctgacagctccagcctcatttaat
aattcgaagagggaataccttgaatgggaggacaaacttggacttgctcacctcagcgac
tttgagtatgatgacggcgacctcatcgtgccgaaagatggcgtgtacgaggtttacctg
cagatcaccttccgaagacctagtcactttgtgtgtagcaaagagggccctgttttcatc
ctctcccagagggtgatcctgtttgcaatgaactaccagaatgacagagaactcctaaca
gcatctgacacagtgtactgcagtcagccccctggctcaaagggctgcatggaggaggac
tcagtggttccttactgggaaaagtctccacgcacttccggagtgtttaaactaaaagct
ggggacaggcttagagtgagtaacgaggacaggtaccatgagttgatgctccttcaagaa
gacaagacattttttggcgcacatctcatttga

DBGET integrated database retrieval system