KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112238377Help
Entry
112238377         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 9-like
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw01100  Metabolic pathways
otw04020  Calcium signaling pathway
otw04114  Oocyte meiosis
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04371  Apelin signaling pathway
otw04540  Gap junction
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112238377
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112238377
   04020 Calcium signaling pathway
    112238377
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112238377
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112238377
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112238377
   04914 Progesterone-mediated oocyte maturation
    112238377
   04916 Melanogenesis
    112238377
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112238377
   04270 Vascular smooth muscle contraction
    112238377
Enzymes [BR:otw01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     112238377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc
Motif
Other DBs
NCBI-GeneID: 112238377
NCBI-ProteinID: XP_024262729
LinkDB All DBs
Position
Unknown
AA seq 1122 aa AA seqDB search
MSECIPAPPSSRWEGNQLLPVFVNTFRWEGNQLLPVFVNTFQVEKALKERLIHSVMPRRV
ADELMKQGDEEMEGRRKRYSAGAFSAVSTIIFRPFNMKRXEPVSILFADIVGFTKMSANK
SAHALVGLLNDLFGRFDRLCELTRCEKXSTLGDCYYCVAXCPEPRPDHAYCCVEMGLGMI
VAIEQFCQETCETVDMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVH
LSEATAGFLDDRYQQEDGRVLERATQGLMEKLKGMKTYLISGRKLEHSQCGCSQDILTPC
PRPHTSALMPGGAASLCVSCTVNGEQTGEGAGLNGCQDEHXTNSAKFTPGCSPRALNGIL
SPPLEDSVMASQSSLCDMLQEKEKKTSTGTGTGTSLGMGGPGGAGPGGTGMDHSALIPLR
SKNFREKSDVHFVDVIKEDSLMKDYFFKPPINKLSLNFLERPLETAYRISYQEEVETQAP
VQTFASPTFSSFLDVLLSCSVFLALTLACFLVPMVTMETPPATVLGLATAAGLLELVSLV
LSIRMTFYLDNVLSCTQTLLRVVSGWIPRHVIGAVLVSLPAVSVFSHLACSLHLPIQVRR
DREGTGGGQTWAIIQYCNFCQLSFWMRSALATAVGVALLVLLHSPLNRTGNLTNETWSTP
EPRPDAMDPVRPLDLLVPEAVLTYFLLLLLVWFLNHEFEVSYRLHYHGNIEADKHRVKIQ
NMRDQADWLLGNIIPIHVAEQLKVTQSYSKNHDNAGVIFASIVNFSEFYEESYEGGKECY
RVLNELIGDFDELLRKPDFANVEKIKTIGATYMAASGLNPQQCIDDSHPNSNHLRALFDF
ALEMMGVLDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTG
VECRVQVSEESHSALSGMGLEFDYRGTVNVKGKGQMRTFLYPRSAERGGQLLAEPWLQPH
QLVAVLPPVKPVQSQATVGPVXEGDAVNTTKSDASANAPAPPPLSSSYTPPTSSSSSTFT
PQASSIGPPVAPSGLGPEPGPAKPCGVRADRAEGYRDAPPIPPGIPQTGAGHPAATGTDP
HPLTLDLDPELVPCTLAQPEEEEEEEANELTKLNKEDFMSRL
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtgcattcccgccccaccttcctcaaggtgggaaggaaaccagttgttacct
gtctttgtgaatacgttccggtgggaaggaaaccagttgttacctgtctttgtgaatacg
tttcaggtggagaaagcgttgaaggaacgcctgatccactctgtcatgccgaggagggtc
gccgatgaactgatgaagcagggggacgaggagatggagggacgccggaagagatactct
gccggggctttttcggctgtgtccacgatcatcttcaggccattcaacatgaagcggnat
gagcctgtttctatcctctttgcggatatcgtcggcttcaccaaaatgtctgccaacaag
tccgcccacgccttggtggggctcctcaatgacctcttcggccgtttcgaccggctgtgt
gagctgacgcgctgtgagaaantcagtacactgggagactgttactactgcgtggcgnng
tgtcccgagccacgccctgaccatgcgtactgctgtgtcgagatgggactaggtatgatc
gtggccattgagcagttctgccaggagacgtgtgagacggtggacatgagggtgggggtc
cacaccggcacggtcctctgtgggatcctggggatgaagcggttcaagttcgacgtgtgg
tccaacgacgtcaacctggccaacctcatggaacaattgggcgtygccgggaaggttcac
ctatcagaggccaccgccgggtttttggatgatcggtaccagcaggaggacgggcgggtg
ttggagagggcgacgcagggcctgatggagaaactgaaggggatgaagacctacctgatc
tcagggaggaagttagagcattctcagtgtggttgctctcaggacatcctgaccccgtgc
cctcgcccccacacctctgccctcatgcctgggggggctgcttccctctgtgtgtcctgc
actgtgaatggggagcagacaggggagggggctggactcaatggatgccaggatgaacat
aygactaacagcgccaagtttactccaggctgcagccccagggctctgaatggcattctc
agtcctccactggaggactcggtgatggccagccagagctctctatgtgacatgctccag
gagaaagaaaagaagaccagtacgggcacagggacgggwaccagcctgggtatggggggt
ccaggaggggcgggaccggggggcacaggcatggaccactcrgccctcatcccgctacgc
tccaagaacttcagggagaagagtgacgtccattttgttgatgtcatcaaggaggacagt
ctgatgaaggactacttcttcaagcctcccatcaacaagctgagcctcaacttcctggag
agacctctggagacagcctaccgcatcagctaccaggaggaggtggagacccaggccccg
gtgcagacctttgccagccctaccttcagctccttcctggatgttctcctatcctgctct
gtgttcctcgccctcaccttggcctgcttcctggttcccatggtcactatggagacgcct
ccggcaaccgtcctgggattggctaccgctgctggtctgttagagctggtctccctggtg
ctgtccatacgtatgacgttctacctggacaacgtgttgagctgtacccagaccttgctg
agggtggtgtcaggctggatcccccgtcatgtgatcggggccgtgctggtctcacttcct
gccgtgtccgtgttctcacacctcgcctgcagcctacacctgcccatccaggtaaggaga
gatagagagggtacaggaggagggcagacatgggccatcatccagtactgtaacttctgc
cagctgagtttctggatgagatctgccctggccacagctgttggtgtggctctactagtg
ctgctccacagccccctcaacaggacaggtaacctcaccaatgagacatggtccactcca
gaaccacgtccagatgccatggaccccgtgagacccctagacctactggtcccagaagca
gtactcacctacttcctcctcctcctattggtctggttcctgaaccacgagtttgaggtc
agctaccgtctccattaccatggcaacatagaggccgacaagcaccgcgtcaagatccag
aacatgcgggaccaggccgactggttgctaggcaacatcatcccaatccacgtcgccgag
cagctcaaggtgacccagtcgtactccaaaaatcacgacaacgccggggttatctttgcg
agtattgtgaatttttctgaattctacgaggaaagttacgaaggcgggaaggagtgttac
cgagtgctcaatgagctcatcggcgacttcgacgagttgctacggaaaccggacttcgcc
aacgtggagaagatcaagacgatcggcgccacgtacatggcggcgtccgggctgaaccct
caacagtgcattgacgactcccacccaaactctaaccacctgagggcgctgtttgacttc
gccctcgagatgatgggtgttttggacgacttcaataaaaacatgctaggctttgggttt
aagctccgtatcgggttcaaccatggtcccctgacggcgggggtgatcggcactaccaag
ttgctctacgacatctggggagacacagtgaatattgcgagtcgcatggactctacaggg
gtggagtgtcgggtacaggtgagtgaggagagccactcggcgctcagtggaatgggctta
gagtttgactaccgcggtaccgtcaacgtcaagggcaaaggtcaaatgaggaccttcctg
tatcccaggagcgctgaaagaggtgggcagctattggctgagccttggctacagccacat
caattagttgctgtwttgcccccggtgaaacctgtccaatcacaggcaaccgttggaccc
gtggyggaaggggacgccgttaatacgaccaagtctgatgcaagtgccaatgcgccagcc
cctcctcctttatcctcttcttacactcctcccacatcctcctcttcctccacattcacc
ccccaagcctcttccataggacctcctgtagctccttcaggactagggccagagccaggc
ccggccaagccctgtggggtgagggcagatcgggcagaggggtacagggacgctcctcca
atcccaccaggaatcccccaaactggggctggccaccccgctgctacgggcacggaccct
cacccccttaccctggacctagacccggagctagtaccctgtaccttggcacagcctgag
gaagaggaggaggaggaagcgaatgagctgacaaagctcaataaggaggatttcatgtca
cgcctttga

DBGET integrated database retrieval system