KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112238546Help
Entry
112238546         CDS       T05605                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00500  Starch and sucrose metabolism
otw01100  Metabolic pathways
otw04910  Insulin signaling pathway
Module
otw_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    112238546
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112238546
Enzymes [BR:otw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     112238546
Glycosyltransferases [BR:otw01003]
 Polysaccharide
  Storage polysaccharide
   112238546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 112238546
NCBI-ProteinID: XP_024262885
LinkDB All DBs
Position
Unknown
AA seq 643 aa AA seqDB search
MPLARSLSITSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPALKRAIDKMNSSGCKVYFGRWLIEGSPYVVLIDVA
FTAWNLDKWKKELWDNFSIGVPWFDREANDAVLFGFLTAWLLGEWLAGTGLGRYAGQRQF
ALATIFTTHAPRHPAGTLLCAGSVDSTTTSLIHNHTPNGRNGKKFSACKSSRTARQSRTV
PGVSIKVVPPARHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDVTV
VAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKMLSK
DDFTMMKRAIFATQRQCQPPICTHNMLEDSNDPILTCIRRIGLFNSSADRVKVIFHPEFL
SSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHI
ADPSAYGIYILDRRYRGVDESCNQLTSYLFQFCQQSRRARIIQRNRTERLSDLLDWRYLG
RYYISARHMALAKAFPDTYFYQPHDSDTAQGFRYPRPASVPPSPSLSRHSSPRQSEAEED
DDRYDEDAEAEKDRLNIRQPLTLPSKKGPALPYTLPGANGERN
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggctcgcagcctgtccatcacctccctgtcggggttggaggagtgggatgag
gagtttgacctggaggacgctgtcctcttcgagatcgcatgggaggtggccaacaaagtt
ggtgggatttacacagtgatccagaccaaagcccgtctgacggcagaggaatggggagaa
aactatttcctggttggtccgtacgtggagagtaacgtccgtacccaggtggagctgatt
gagcccaccaaccctgcccttaagagagccatagacaagatgaattccagtggatgtaag
gtgtactttggtcgttggctgattgagggcagtccatacgtggtgctgatagatgtggcg
ttcactgcctggaacctggataagtggaaaaaagagttgtgggacaacttctctattggg
gtgccctggttcgaccgcgaggccaacgacgccgtcctctttggcttcttgaccgcctgg
ttactaggagagtggctggcaggcactgggcttgggcgctatgcaggacagagacagttt
gccctggcaaccatcttcaccacccacgcaccacgccaccctgctgggacgctactgtgt
gccggcagcgtggactctacaacaacctcgctgatacataatcacacccctaacgggcgg
aacgggaagaagttctctgcctgcaagagttccagaactgcacgccagagcagaaccgta
ccaggagtttccatcaaggttgtcccacccgccaggcacctggacttcaacctggacaag
tgtctgttcctgttcatcgctgggaggtatgagttcagcaacaaaggagctgatatcttc
ttggaggctttggccagactcaactatctactgagagtcaaccacagcgatgtgactgtc
gttgcgttcttcatcatgcctgcacggaccaacaacttcaacgtggagacgctgaaaggc
caagcagtcaggaagcagctctgggataccgctcaaacagtgaaggaacgcttcggaaag
aaactatatgaatcactgctggttgggcagttgccggacgtgtccaagatgctgagtaag
gacgacttcaccatgatgaagcgtgccatctttgccacccagaggcagtgccagcctccc
atctgtacccacaacatgctggaggacagcaacgaccccatcctcacttgcattcgccgc
atcggcctgttcaacagctctgccgaccgcgtcaaggtgatcttccacccagagttcctg
tcctccacctctcccctcctgccaatggattatgaagagtttgtaagaggctgccatctt
ggagtgttcccctcttactatgaaccatggggatatacaccagctgagtgtacagtcatg
gggatcccctcaatctctaccaacctctctgggtttggctgcttcatggaggaacacata
gctgatccctcagcatacggaatctacatccttgatcgacggtacagaggggttgatgag
tcatgtaaccagctcacgtcgtacctgttccagttctgtcagcagagccggcgcgccagg
atcatccaacggaaccgaaccgagcgcctgagtgaccttctggactggagatacctgggc
aggtattacatatcagctcgtcacatggccctggctaaagccttcccagatacctacttc
taccaacctcatgactctgacactgcccaaggtttccgttaccctagaccggcctctgtg
cccccatctccgtctctgtcgcgccactcctccccccgccaaagcgaggcggaagaagat
gatgaccgctatgatgaagatgcagaggcagagaaagaccgcttgaacatccgccagccc
ttgaccctgcctagtaaaaagggtcccgccttgccttacaccctgccaggtgccaatgga
gagagaaactga

DBGET integrated database retrieval system