KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112238956Help
Entry
112238956         CDS       T05605                                 

Gene name
slc12a8
Definition
(RefSeq) solute carrier family 12 member 8 isoform X1
  KO
K14428  solute carrier family 12 (potassium/chloride transporters), member 8
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:otw02000]
    112238956 (slc12a8)
Transporters [BR:otw02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   112238956 (slc12a8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-GeneID: 112238956
NCBI-ProteinID: XP_024263251
LinkDB All DBs
Position
3
AA seq 766 aa AA seqDB search
MEAMPFGWMLHRSNVEDVTELLKTRESRRASGSKTTPVQDLFHEDAQGSQHLSQPWWRVK
LFVWEPVLFGTWDGVFTTCMINIFGVVLFLRTGWLVGNLGVLLGMLLVSVVVIVALVTVM
SGIGVCERCGVGSGGVYSMISTVLGGRVGGTVGLLYVFGQCVAGAMYITGFSESIAQLLS
LQSEWAVRGMSVAVLLGLLGINLAGVKWIVRLQLILLAVLAVSTLDFVIGTFSHLDPEHG
FVGYSEELLRKNTLPDYTTGEGFFTVFGVFFPAATGVMAGFNMSSDLQRPEHNIPVGTLA
AVCTSWFLYLVFVFLLGAICTREALHFDFLIAEKVSLVGFLFLLGLYISSLASCMGGLYG
APRILQVIAQERVIPALAFLAQGKGPNKTPVAAIVLTSLLTMAFIFIGQVNVLAPIVTIN
FMLTYSFIDYSYFSVAMTYNLQPREKRVGPAKRPGTGASSFTNHTSKPLMTTTHQGYGTE
GDVSSPGKGTLLEFTRDMDQIFPLPNGGEQEETEKDKATEKVSMPGLRGRIRRVKAPAKK
TLMDSFGLDLNSNAFPSEGDGEGDGGVDPAPPGLGECIFPQERPGEPSPDPEEVIQDKTL
LPGRNPIELDPPGSQRQNTGSDCKPDYQGSEIQLMPDSFYAKFCNHWIALIGALCSILIM
FVIQWVYALANIIVALVLFLYIGKASPGLPIGVASRFSFFRWIKTTLSNLGRGELPRDQI
IVTPSLSGVGMETRQLTEENLDFASRDRYHQSSFIEPDRMAHLQLN
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgatgccattcggctggatgctccacaggtctaacgtggaggatgtgacagaa
cttctgaagactagggagtctaggagggccagcggcagtaaaaccacacctgtccaggat
ctgttccatgaggacgctcaggggtcgcagcatctctctcagccatggtggagggtgaag
ctgtttgtgtgggagcctgtcctgtttgggacgtgggacggagtgtttactacctgtatg
atcaacatctttggtgtggtgttgttcctccgcactgggtggctggtggggaacctaggt
gtattgctaggtatgctcctggtatccgtggtggttatcgttgccctggtaacagtgatg
tcaggcatcggcgtctgcgagcgctgtggggtcggtagtggtggagtttactccatgatc
tctactgtcctgggaggaagagtaggtgggaccgtggggctcctgtatgttttcggccag
tgtgtggctggagccatgtatatcacagggttctcagagtctattgctcagctcctgagc
ctgcagagtgagtgggccgttagagggatgtctgtggctgtcctgctcggccttctgggt
attaacctcgccggggtcaaatggatcgtccgtctccagctgatactactggccgtgctg
gctgtctcaacgctggacttcgttattgggacgttttcccacctcgacccagagcatggc
tttgtagggtactccgaggagctgctacgtaagaacactctaccagactacacgacagga
gaaggattcttcactgtgtttggagtgttcttccccgctgctacaggtgttatggcaggt
ttcaacatgagctcagatctgcagagaccggaacacaacatccctgtgggaacactggct
gccgtctgtacctcatggttcctgtatctggtctttgtgttcctgctgggagccatctgc
accagagaggcactgcacttcgacttcttaatagcagaaaaggtctccttggtgggtttc
ttgtttctcctgggcctctacatctcctcgctggcctcctgcatgggcggtctgtacggg
gcacccaggatcctccaggtcatcgcccaggagagggtcatcccagccctcgccttcctg
gcacaagggaaaggtcctaataagactccggtggcggccatagtcttgactagcctgctg
accatggctttcatcttcatcggacaggtcaacgtcctagcccccatcgtcaccatcaac
ttcatgctcacctacagcttcattgactactcctacttcagtgtggcgatgacctataac
ctccagcccagagagaagagggttggtcctgccaagaggcctgggactggagcctcatcc
ttcacaaaccatacatccaagcccctcatgaccaccacccaccagggttatggtacagag
ggggatgtttcgagcccagggaaggggactctgttagagtttactagggatatggaccag
atctttcccctgcccaatggtggtgaacaggaggagacagaaaaggacaaggccacagag
aaggtttccatgccaggcctgagaggcaggatcaggagggtgaaagcccctgccaagaag
actctgatggacagctttgggctagaccttaacagcaatgccttccctagtgagggagat
ggagaaggagatggaggggttgatccggctcccccaggtctaggagagtgtatcttcccc
caggaaagacctggagagcccagcccagacccggaggaagtgatacaggacaagaccctc
cttcccggtcgtaaccccatagagcttgaccctccagggtcacagagacaaaacactggt
tctgactgtaaaccagactaccagggatcagaaatccaactgatgcctgattccttctat
gccaaattctgcaaccactggattgcactgattggtgcattatgttccatcctgatcatg
tttgtcattcagtgggtctacgccttggccaatataatagtcgccttggtcctcttcctc
tacattggaaaagcaagccctggacttccaataggagtggcatctcgtttcagctttttc
agatggattaagacaaccctgagtaacctaggaaggggtgagcttcctcgggaccagatt
atcgtgacaccctctctgtcaggagtcggcatggaaactaggcagctgacagaggaaaac
ctggactttgcctctcgggaccgctaccaccagtcttcctttatcgaaccagacaggatg
gcgcacctacaacttaactaa

DBGET integrated database retrieval system