KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239157Help
Entry
112239157         CDS       T05605                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112239157 (mapk6)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112239157 (mapk6)
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112239157 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 112239157
NCBI-ProteinID: XP_024263421
LinkDB All DBs
Position
Unknown
AA seq 792 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAIDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNTVKVFETLGPSGRHLTEDIVSLTEVNSVYIVQEYMETDLCQLLE
RGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFTEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIHGDMSQPHNPLAKLLPDVSPQALDFLQKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDEGHSHTWDSRYRDSQ
LSEGDWHLHTHSILDTDEVQVDPRALSDQTDEEEVQVDPRKYADGDREILDDPSYGYSSL
FTPERSWPDPDDEHFDLHHENKYCDLECSHTCNYKVVSPSYLDNLIWRDSEVNHYYEPKL
IIDLSNWKEQQSKEKQAQAAGRDKEHKAQKRKCEKNGLVKAQMVLQVEKSPVEKDSQQEK
NQTQTTQQNQGFDFDSFIAGTIKLSLRTEPSDVGLLGDVGLLSEVGVGLLSEVGLLNELN
SSVSQLEAPRSGSMSKTISQEKEEKCLVNFAQVSITVGTAGSGARPAHPWESFGGGERVE
ERRGGCLMDGAGRWDVGKEEQLQKDSCYTSYLDRLFSRKDEGSGESAASAADTPEPEPSD
VGVERERDEGGFLARSGEIMFNMQLDSLALPGFDATTDVPLKSIQASLAPSTVKCSPQIA
HTTYSSFFKHLN
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagtttgagtctctgatgaacatccacgggtttgacctgggcccacgttac
atggacctgaagcctctgggctatggagggaacggcctggtgttctcagccatcgacacg
gactgcgacaaacgagtggcggtgaagaagatcattctgacggatcctcagagcgtcaaa
cacgccctgagagagatcaagatcatcaggaggctggaccacgacaacaccgtcaaggta
tttgagacccttgggcccagcggtcgtcacctaacagaggacatagtctctctgacagag
gtgaactctgtgtacatcgtccaggagtacatggagaccgacctgtgtcagctcctggag
aggggtctactctctgaggatcacgccagactcttcatgtaccagctgctgagaggcctc
aagtacatccactctgccaacgtactgcacagagacctgaagcctgccaacttgttcgtc
aacacagaggacctggtgctgaagataggagactttggactggcccggatcatggatcct
cactactcacacaagggtcatctttctgagggcttggtgactaaatggtaccggtctcct
cgcctgctgctctctcctaacaactacaccaaggccattgacatgtgggctgccggatgc
atcttcactgagatgctcactgggaaaacgctcttcgcaggagcccatgaactggagcag
atgcagctgatcctggagtccatccctgtgctgagagaagaggacaggcaggagttacac
agtgttatccccgtcttcatacacggtgacatgtcccagccgcacaacccactggccaag
ctactgcccgacgtcagcccacaggccctggatttcctgcaaaagatcctgacctttaac
cccatggaccgtctgacagcagaagaagccctagcccacccttacatgtctgactactcc
ttccccctggacgaacccgtctcgctgcaccccttccacatagaggatgaggtggatgat
atcttactgatggacgagggtcacagccacacctgggacagcaggtaccgtgacagccag
ctttcagaaggggactggcatctccacacccacagcattctggacactgacgaggtacag
gtggaccctcgggctctgtctgaccaaactgacgaggaggaggttcaggtggaccctcgt
aagtatgcagacggagaccgggagatcctggacgatccttcctacggctactcctccctc
ttcactcccgaacgctcgtggcccgaccccgatgacgaacactttgaccttcaccacgag
aacaagtactgtgacctggagtgttcccacacctgtaactacaaggtggtgtctccatcc
tacctggataacctgatctggagggacagcgaggtcaaccactactacgagcccaagctc
attatagatctgtccaactggaaggagcagcagagtaaagagaaacaggctcaggctgca
ggcagagacaaggagcacaaggcccagaagagraagtgtgagaagaacggcctggtgaag
gctcagatggttctacaggtagagaagagcccggtggagaaggactcccagcaagagaag
aaccagacccagactactcaacagaatcaaggctttgactttgactccttcatcgccggc
accatcaaactgagcctgcgaactgagcccagcgacgtgggactcctgggggacgtgggc
ctcctgagcgaggtgggagtgggcctcctgagcgaggtgggcctcctgaacgagctcaac
tcgtctgtgtcccagctggaggctccgcggtcaggctccatgtccaaaaccatcagccag
gagaaggaggagaagtgcctggtgaactttgctcaggtcagcatcaccgtggggaccgct
gggtctggggcacgtcccgcacacccctgggagagcttcggaggaggggagagggtggag
gagcggagaggtgggtgtctgatggacggggcggggcgctgggacgttgggaaagaggag
cagctccagaaggacagctgctacaccagctacctggacagactgttcagcaggaaggac
gagggcagcggggagagtgctgctagcgccgccgacaccccagaacctgagccctcggat
gtgggagtggagagggaacgggacgaggggggcttcctggcgcggagcggagaaatcatg
tttaacatgcagctggactctctggcgctgccgggattcgatgctacgaccgacgtgccg
ctcaaatccatccaggcctccctcgctccctccacggtcaaatgctcgcctcagattgcc
cacacaacctacagcagcttcttcaagcatctgaattaa

DBGET integrated database retrieval system