KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239225
Entry
112239225         CDS       T05605                                 

Definition
(RefSeq) catenin beta-1-like
  KO
K02105  catenin beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112239225
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239225
   04520 Adherens junction
    112239225
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112239225
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112239225
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 Atx10homo_assoc Queuosine_synth
Other DBs
NCBI-GeneID: 112239225
NCBI-ProteinID: XP_024263480
LinkDB
Position
Unknown
AA seq 790 aa
MASQSDLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDNQ
VLYEWEQGFSQSFTQDQVSDIDGQYAMTRAQRVRAAMFPETLDEGMQLPSTQFDGAHPTN
VQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKK
EASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALV
KMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQTTLAEVDVMQEGMEGLLGTLVQLLGS
DDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHL
TSRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQG
AIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIR
GLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGV
ATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMTWNETGDLGLDIGAQGDALGYRQ
EDPSYRSFHSGGYGQDSMGMDSMMDHDMGAHHPGPEYPVDGLTDLGHAQDLIDGLPPGDS
NQLAWFDTDL
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggcttcccagtctgatctgatggagctggacatggccatggagcctgaccggaaggct
gcagtgagccactggcagcagcagtcgtacctggactctggtatccactcaggggctacc
accaccgccccctccctgagtgggaagggcaacccagaggaggaggatgtggataaccag
gtgctgtacgagtgggagcagggcttctctcagtccttcacacaagatcaagtgtcagac
attgacgggcagtatgccatgaccagagcccagagggtgcgtgcggccatgtttccagag
accctggacgagggcatgcagctcccctccacccagtttgatggggcccaccccaccaac
gtgcagcggctggctgagccctctcagatgctgaagcatgccgtggtgaacctcatcaac
tatcaggatgacgccgagctggccacgcgtgccatccctgagctgaccaaactactcaac
gacgaggaccaggtggtggtgaacaaggctgcagtgatggtgcaccagttgtccaagaag
gaggctagccgccacgccatcatgcgctccccccagatggtgtcggcaattgtgcgcacc
atgcagaacaccaacgatgtggagacggcacgctgcactgccggcaccctgcacaacctg
tcccaccacagagagggtctgctggccatcttcaagtccgggggcatccccgcccttgtc
aaaatgcttgggtccccagtggactcagtgctgttctacgccatcaccaccctacacaac
ctgctgctccaccaggagggtgccaagatggctgtgcgtctggccgggggcctgcagaaa
atggtggccttgctcaacaagaccaacgtcaaattcctcgccatcacaacagattgcctt
cagattcttgcctacggcaaccaagaaagcaagcttatcattctggccagcggtgggccc
caggccctggtcaacatcatgaggacatacacatatgaaaagctgttgtggactaccagt
agagttctcaaagtgctctctgtctgctccagcaataagcctgccatcgtagaggctggt
ggtatgcaggctcttgggcttcacctcacagaccccagtcagagactagtccagaactgc
ctgtggaccctcaggaacctgtcagacgctgccaccaaacagacgaccttagctgaagta
gatgtgatgcaggagggtatggaaggtctgctggggaccctggtccagctcctgggctct
gatgacatcaacgtggtgacgtgtgctgccggcatactgtccaacctcacctgcaacaac
tacaagaacaagatgatggtgtgtcaggttggggggattgaggcgctggtccgtaccgtg
ctgcgtgccggagaccgcgaggacatcactgagccggccatctgcgccctgcgccacctc
accagccgccaccaggatgctgagatggcccagaatgctgtgcggcttcactacggcctg
cctgtggtggtcaagctgctgcatcccccctcccactggcccctcatcaaggccactgtg
ggcctaatccgtaacctggctctgtgtccagccaaccatgcccctctgcgtgagcagggg
gccatccccagactggtgcaactgctggtcagagcccaccaggacacccagagacgcacc
tccatgggaggcacccagcagcagtttgtggagggagttcgtatggaggagatcgtggag
ggctgtactggcgctctgcacatcctggctagagacgtccacaacagaatcgtcataaga
ggactcaacaccattccactctttgtccagctgttgtattctccaattgagaacattcag
cgtgtggctgcaggagttctgtgtgagttggcccaggacaaggaggcagcggaggccatc
gaggctgagggcgccaccgcccccctcacagagctgcttcactccagaaacgagggcgtg
gccacctatgctgctgctgttctgttccgtatgtctgaagacaagccccaggactataag
aagcgtctgtctgtggagctcaccagctccctgttcaggacggagcctatgacctggaac
gagacaggagatctgggcctggacatcggcgctcagggagatgccctgggctaccgtcag
gaagaccctagctatcgctccttccactctgggggatatgggcaggactccatgggtatg
gactccatgatggaccatgacatgggtgcccaccaccccggccctgaatacccagtcgac
gggctgaccgacctgggccacgcccaagacctgatcgatgggcttcccccaggcgacagc
aatcagttggcttggtttgatactgacctgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239227
Entry
112239227         CDS       T05605                                 

Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04310  Wnt signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112239227
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239227
   04520 Adherens junction
    112239227
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112239227
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112239227
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 Atx10homo_assoc Queuosine_synth
Other DBs
NCBI-GeneID: 112239227
NCBI-ProteinID: XP_024263481
LinkDB
Position
Unknown
AA seq 790 aa
MASQSDLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDNQ
VLYEWEQGFSQSFTQDQVSDIDGQYAMTRAQRVRAAMFPETLDEGMQLPSTQFDGAHPTN
VQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKK
EASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALV
KMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQTTLAEVDVMQEGMEGLLGTLVQLLGS
DDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHL
TSRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQG
AIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIR
GLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGV
ATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMTWNETGDLGLDIGAQGDALGYRQ
EDPSYRSFHSGGYGQDSMGMDSMMDHDMGAHHPGPEYPVDGLPDLGHAQDLIDGLPPGDS
NQLAWFDTDL
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggcttcccagtctgatctgatggagctggacatggccatggagcctgaccggaaggct
gcagtgagccactggcagcagcagtcgtacctggactctggtatccactcaggggctacc
accaccgccccctccctgagtgggaagggcaacccagaggaggaggatgtggataaccag
gtgctgtacgagtgggagcagggcttctctcagtccttcacacaagatcaagtgtcagac
attgacgggcagtatgccatgaccagagcccagagggtgcgtgcggccatgtttccagag
accctggacgagggcatgcagctcccctccacccagtttgatggggcccaccccaccaac
gtgcagcggctggctgagccctctcagatgctgaagcatgccgtggtgaacctcatcaac
tatcaggatgacgccgagctggccacgcgtgccatccctgagctgaccaaactactcaac
gacgaggaccaggtggtggtgaacaaggctgcagtgatggtgcaccagttgtccaagaag
gaggctagccgccacgccatcatgcgctccccccagatggtgtcggcaattgtgcgcacc
atgcagaacaccaacgatgtggagacggcacgctgcactgccggcaccctgcacaacctg
tcccaccacagagagggtctgctggccatcttcaagtccgggggcatccccgcccttgtc
aaaatgcttgggtccccagtggactcagtgctgttctacgccatcaccaccctacacaac
ctgctgctccaccaggagggtgccaagatggctgtgcgtctggccgggggcctgcagaaa
atggtggccttgctcaacaagaccaacgtcaaattcctcgccatcacaacagattgcctt
cagattcttgcctacggcaaccaagaaagcaagcttatcattctggccagcggtgggccc
caggccctggtcaacatcatgaggacatacacatatgaaaagctgttgtggactaccagt
agagttctcaaagtgctctctgtctgctccagcaataagcctgccatcgtagaggctggt
ggtatgcaggctcttgggcttcacctcacagaccccagtcagagactagtccagaactgc
ctgtggaccctcaggaacctgtcagacgctgccaccaaacagacgaccttagctgaagta
gatgtgatgcaggagggtatggaaggtctgctggggaccctggtccagctcctgggctct
gatgacatcaacgtggtgacgtgtgctgccggcatactgtccaacctcacctgcaacaac
tacaagaacaagatgatggtgtgtcaggttggggggattgaggcgctggtccgtaccgtg
ctgcgtgccggagaccgcgaggacatcactgagccggccatctgcgccctgcgccacctc
accagccgccaccaggatgctgagatggcccagaatgctgtgcggcttcactacggcctg
cctgtggtggtcaagctgctgcatcccccctcccactggcccctcatcaaggccactgtg
ggcctaatccgtaacctggctctgtgtccagccaaccatgcccctctgcgtgagcagggg
gccatccccagactggtgcaactgctggtcagagcccaccaggacacccagagacgcacc
tccatgggaggcacccagcagcagtttgtggagggagttcgtatggaggagatcgtggag
ggctgtactggcgctctgcacatcctggctagagacgtccacaacagaatcgtcataaga
ggactcaacaccattccactctttgtccagctgttgtattctccaattgagaacattcag
cgtgtggctgcaggagttctgtgtgagttggcccaggacaaggaggcagcggaggccatc
gaggctgagggcgccaccgcccccctcacagagctgcttcactccagaaacgagggcgtg
gccacctatgctgctgctgttctgttccgtatgtctgaagacaagccccaggactataag
aagcgtctgtctgtggagctcaccagctccctgttcaggacggagcctatgacctggaac
gagacaggagatctgggcctggacatcggcgctcagggagatgccctgggctaccgtcag
gaagaccctagctatcgctccttccactctgggggatatgggcaggactccatgggtatg
gactccatgatggaccatgacatgggtgcccaccaccccggccctgaatacccagtcgac
gggctgcccgacctgggccacgcccaagacctgatcgatgggcttcccccaggcgacagc
aatcagttggcttggtttgatactgacctgtaa

DBGET integrated database retrieval system