KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239349
Entry
112239349         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: vinculin-like
  KO
K05700  vinculin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239349
   04520 Adherens junction
    112239349
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112239349
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112239349
   04147 Exosome [BR:otw04147]
    112239349
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112239349
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112239349
SSDB
Motif
Pfam: Vinculin Mob_Pre LIM_bind CARD
Other DBs
NCBI-GeneID: 112239349
NCBI-ProteinID: XP_024263592
LinkDB
Position
Unknown
AA seq 972 aa
MLKADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVES
MEDLITYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVKSMNTVKELLPVLISGIKIFV
TTKTSGSQGVEESLKNRNFTFEKMSAEINEIIRVLQLTSWDEDAWANKDTEAMKRALALI
DSKMTQAKSWLRDPDAQPGDAGEQAIRQILDEAGKVGELCAGKERRDILGTSKTLGQITD
QVSEMRARGQGASPAPSRRPSRSQGLDVLAGRVENAGRKLEAMTNSKQSSPRXIDAAQNW
LADPNGGPEGEENIRALLSEAKKIADMCETPRXESDILRSIERMAALTAKLSELRRQGKG
DTPEARALAKQIATALQNLQSKTSKAVANSRPAKAAVHLEGKIEQAQSWMENPTMDDGGV
GQAAIRGLVAEGRRLANALPGPYRQELVGKCEQVEQLMAQLADLAARGDGESPQARAVAQ
HLQESLKNLKGTMQEAMTQEVSDIFSDTTTPIKLLAVAATAPPNAPNRDQVFDERAANFE
NHANKLAATAEKAAAVGTANKSTVEGIQAAVKSTRDITPQVVSAARIMLRNPGNQAALEH
FETMNNQWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLEKCRAAMANHQPQMLVVGAT
SIARRANRILLVAKREVENSEDPRFREIVKAASDELSRTISPMVMNAKAVAGNITDPSLQ
KGFLDSGHRILGAVAKVRDAFQPQEPDFPPPPPDLDQLHVSDEPAPPKPPLPEGEVPPPR
PPPPEEKDEDFPEQEVGEMVSEPMMMAARQLHEEARKWSSKGNDIIGAAKRMALLMAEMS
RLVRGAGGNKRALIQCAKDIAKASDEVTKLAKEVAKQCTDKRIRTNLLQVCERIPTISTQ
LKILSTVKATMLGRTNISEEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGF
TLHWIRKTPWYQ
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgttgaaagcagacccttactccgtccctgctcgagattacctcatcgacggctcccgt
ggaatactctctggcacctctgacctgctgctcaccttcgacgaggctgaggttcgtaaa
atcatccgtgtgtgtaaaggtatcctggagtacctgaccgtggcagaggtggtggaatcc
atggaggatctgatcacgtacaccaagaacctgggacctgggatgacgaagatggccaag
atgattgacgagagacagcaggagctgacccatcaggaacatcgcgtgatgctggtcaag
tctatgaacactgtcaaggagttgctccctgtcctcatctcaggtatcaagatctttgtg
acgaccaagacgtccggcagccagggagtagaggagtctctgaagaacaggaacttcacc
ttcgagaagatgagcgctgagatcaacgagatcatcagagtgctgcagctcacttcctgg
gatgaagacgcctgggccaataaggatacagaggccatgaagagagctctggcgctcatc
gactctaagatgacccaggccaagagctggctgagggaccccgacgcccaaccaggggat
gcaggggaacaggccatccgtcagatcctggatgaggctgggaaggtgggagagctgtgt
gctgggaaggagcggagggatatcctgggaacatccaaaaccctggggcaaatcactgac
caggtgtctgagatgagggccaggggtcagggggcatctcctgcaccaagcagaaggccc
agcaggtcccagggcctggatgttctcgcggggagagtggagaatgcaggccggaaactg
gaggccatgaccaactccaaacagtcatcgccaaggnngattgacgctgctcagaactgg
ctggcagaccctaacggtggtcctgagggagaggaaaacattagagctctcctgtctgag
gccaagaagatcgctgacatgtgtgagaccccaaggnnagagagtgacatcctgaggtcc
atcgagaggatggctgctctcaccgccaagctctctgagctccggagacagggtaaaggt
gatactccggaggccagggcattggcgaagcagatagccacagccctacagaacctgcag
tctaagaccagcaaggctgtcgccaacagcaggcctgccaaggctgctgtccacctggag
gggaagatagagcaggcccagagctggatggagaaccccaccatggatgatgggggagtg
ggccaggcagctatccgggggctggtggcggagggccgtcgtctggctaacgctctgcca
ggtccctacagacaggagctggtagggaagtgtgagcaggtggaacagctgatggcccag
ctagccgacctggccgccaggggtgatggggagtccccgcaggcgcgtgccgtggctcaa
catctccaggagagcctgaaaaacctcaaaggaacgatgcaggaagcgatgacacaggag
gtgtccgacatatttagcgacacaaccacacccatcaaactgctggctgtggccgccacc
gccccacccaacgcccccaacagggaccaggtgtttgatgagagggcggccaactttgaa
aaccacgccaacaagctggctgccacggcagaaaaggctgctgctgtaggaaccgctaac
aagagcactgtggaggggatccaagctgccgtcaagtctacaagagatattacaccacag
gtggtctctgctgcccgtatcatgctgagaaacccaggcaaccaggctgcgttggagcac
tttgagaccatgaacaaccagtggattgacaacgtggagaaaatgacaggtttggtggac
gaggctatagacaccaagtctctgttggatgcctctgaggaggctattaagaaagacctg
gagaaatgtcgcgctgccatggctaaccaccagccccagatgttagtggtaggggccacc
agcatcgcccgtcgggccaaccggatcctcctggtagccaaacgggaggtggagaactct
gaggatcctagattcagggagatagtgaaggctgcgtctgatgagctgagccggaccata
tctcccatggtgatgaacgccaaggctgtggctgggaacatcaccgatccaagtctgcag
aaaggcttcctggattcaggccataggatcctgggggccgttgccaaggtgagagatgcg
ttccagccacaggaaccagacttccccccaccaccacctgatctggaccagctgcacgtc
agcgacgagcccgccccaccaaaaccacctctccccgagggtgaggttcctccccccaga
ccccctcccccagaggagaaggacgaggacttcccagagcaagaggtgggagagatggtg
agcgagcccatgatgatggccgccagacagctccacgaggaggcccgcaagtggtccagc
aagggtaacgacatcatcggtgcagccaagagaatggctctgctcatggctgagatgtcc
cgtctggtgcgcggtgccggcggaaacaagcgtgccctcattcagtgtgccaaagacatc
gcaaaagcctcagacgaggtcacaaagttggccaaggaggtggccaagcagtgcacagac
aaacgcatccggaccaacctgctccaggtgtgtgagcgcatccctaccatcagcacacag
ctgaagatcctctccacagtcaaggccaccatgttgggtcgtaccaacatcagcgaggag
gagtccgagcaggccacagagatgttggttcacaatgcccagaacctgatgcagtctgtg
aaggagacggttagagaggccgaggccgcctccatcaagatccggacggatgccggtttc
accctgcactggatccgaaagaccccctggtaccagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245009
Entry
112245009         CDS       T05605                                 

Definition
(RefSeq) vinculin-like isoform X1
  KO
K05700  vinculin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245009
   04520 Adherens junction
    112245009
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245009
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112245009
   04147 Exosome [BR:otw04147]
    112245009
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112245009
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112245009
SSDB
Motif
Pfam: Vinculin PFL-like
Other DBs
NCBI-GeneID: 112245009
NCBI-ProteinID: XP_024268710
LinkDB
Position
Unknown
AA seq 1129 aa
MPVFHTKTIEGILEPVAQQISHLVIMHEDGEVDGKAIPDLTGPVAAVQAAVSNLVRVGKE
TVQTTEDQVMKRDMPPAFIKVENACSKLVQAAQMLKADPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEIVETMEDLITYTKNLGPGMTKMSKMIEERQQ
ELTHQEHRQMLFNSLNTVKQLLPVLISAIKIFVATKSTHSAGVDEAERNRCFTFEKMSAE
ISEIIRVLQLTTWDEDTWANKKDMECMKRSLAVIEAKMTMAKGWLKDSHGQPGEPGDVAV
RVILDEAGKVGELCAGRERRDTLGTAKTLGQMTDQVTELRVRGHGLSPPCVQRAGQCSQG
LDLLLEKVDGAIHRLEALTKAKLAFARRLDAAQAWLADPNGGPEGAENIRALLANAQKIA
DLCEDLLERDDIQRSINEIAGLTARLVELRKRGKGDSPEVRALCKLIGAALLTLQAKTNR
AVANMRPAKPAITLQGKMEQALRWVNNPGQDDRGVGQAAIRGLLSEGRRLAGGLGGPYRQ
DMIVCCDRNEALMTSLADIAGRGEAEAPQAKATASQLQESLKDLKGRMQEVMTQEVSDVF
SDTTTPIKLLAVSATAPPEAPHREEVFDERAGNFEAHAGRLGATAEKAAAVGSANKNTVE
GIQATVKHTRELTPQVTSAARILLKNPGNQAAYEHFDTMKNQWIDNVEKLTGLVDEAIDT
KSLLDASEEAIKKDIDKCRVAIANVQPQMLVAGATSIARRANRVLLVAKREVENSEDPWF
REAVKRASDILSHTISPMVIDAKAVAGNIQYPALQKAFLDSCLRILAAVGKVREAFSLPE
PDFPPPPPDLDKLHVSDQEQAPPKPPLPEGEVPPPRPPPPEEKERDKDEDFPEQKAGELL
SEPMMVAARQLHDEARKWSSKPEEEEGVEVDDEDEFTDGEDDYEPELLMMPSNGNAVNQP
ILAAAQSLHQEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGNKRAMIQCAKDIAKA
SDEVTRLAKEVAKQCTDRRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISEEESE
QATEMLVHNAQNLMLSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgccagtgttccacacgaagaccatcgagggcatccttgagccggtggcccagcagatc
tcccacctggtcatcatgcacgaggacggggaggtggacgggaaggccatcccggatctg
accggcccggtggccgcggtacaagcagcggtcagtaaccttgtcagggtgggaaaggag
actgttcagacaacagaggaccaggtgatgaagagagacatgcctcccgccttcataaag
gtggagaatgcgtgttctaagctcgtgcaggcagctcagatgttgaaggcggatccctac
tcggtgcctgccagagactacctcattgacggttccagaggaatcctgtctggaacctca
gacctgctgctcactttcgacgaagctgaggtgcgtaagatcattcgtgtgtgtaagggg
atcctggagtatttgactgtagctgagattgtggagaccatggaggacctgatcacctac
accaagaacctaggaccaggtatgactaagatgtctaagatgattgaggagcgacagcag
gagttgacccatcaggaacacagacagatgctattcaactccctgaacactgtcaaacaa
ctactgcctgtactcatatcagccataaagatatttgtagcgactaagagcacgcatagt
gctggggtggatgaggcagagagaaacagatgctttacgtttgagaagatgagtgctgag
attagtgagatcatcagagtcctacagcttaccacctgggatgaagacacatgggccaac
aagaaggacatggagtgtatgaaacgttctctggcggtgatagaggctaagatgaccatg
gcgaaaggctggctcaaagactcccatggacaaccaggcgagcccggggatgtagcggtg
cgtgtgatattggatgaggcagggaaggtaggagaactgtgtgctggaagggaacgcaga
gacacacttggaacagcaaagactctgggacagatgactgaccaggtcacagagctacgt
gtcagaggacatggtctgtctccaccatgtgttcagcgggccggtcagtgttctcagggt
ctggacctgctgcttgagaaagtggacggtgccatccacaggctcgaggctttaactaaa
gctaaactggcattcgctaggagactggatgctgcccaggcatggctggcagatcctaat
gggggtccagagggtgcagaaaacatcagagccttgctggccaatgcccaaaaaattgct
gacctgtgcgaagacctcctcgagagagacgacatccagagatccatcaatgagattgcg
gggctcaccgcacgactagtggagctacgcaagcggggtaaaggggatagtccagaggtg
cgtgcgctatgtaaactcattggagcagctctcctgaccctgcaggctaagaccaacaga
gcggtggccaacatgaggcctgccaaaccagccatcactctgcaaggcaagatggagcag
gccctacgctgggtcaacaaccctggacaggatgacaggggtgtgggtcaggcagcaatc
cggggcttgttatcggagggccgccggttggctggagggcttggggggccgtaccggcag
gacatgattgtctgctgcgatcgcaacgaggcgctgatgacatcactggcagacatagcg
gggaggggagaggccgaagccccgcaggctaaagctactgcttcacaactacaggaaagt
ctgaaggacttgaagggtcgtatgcaggaagtcatgacccaggaagtatccgatgtgttc
agtgacaccaccacccccattaaactactggctgtgtctgcgactgcccccccagaggcc
ccacacagagaggaggtgtttgatgagcgtgctggtaactttgaggcccatgcgggtcgc
ctgggcgcaacagcggagaaggcggcggccgtgggatcagctaataaaaacacagttgag
ggaatacaggctaccgttaaacacaccagagaactcactccacaggtgacctccgcagct
cgtatcctgttgaagaatccaggtaaccaggcggcctacgaacactttgacaccatgaag
aaccagtggatcgacaatgtagagaaactcactggtctggtggatgaagccatagacacc
aagtctctgctggatgcgtctgaggaggcgataaagaaggacatcgataagtgtcgtgtc
gccatagcgaatgtacagccacagatgctagttgccggggcgaccagcatagctcggcga
gccaatcgcgtacttctggtagcgaagagagaggtggagaactcagaggacccatggttc
agagaagcagtgaaacgtgcatcagatatacttagccacactatatcacctatggttata
gacgctaaggctgtggcaggaaatatacagtatccagcccttcagaaggcctttttagat
tcttgcctcagaattctggctgctgttgggaaggtcagagaagccttcagcctcccggaa
ccagacttcccccctccacccccagacctagacaagctacacgtgagtgatcaggagcag
gccccgcctaagccccccctaccagagggagaggtgcccccaccccgccccccacctcca
gaggagaaagagagagacaaagatgaagactttccagagcagaaggcaggagagctgctc
agtgagcccatgatggtggctgctaggcaactacacgatgaggcacgcaagtggtccagc
aagcctgaggaagaggagggtgtagaggtagatgatgaagacgagtttactgacggtgag
gatgactatgagccagagctgttaatgatgccgtctaacggcaatgcagtaaatcaaccc
atcctagctgccgcacaatcgcttcatcaggaggcgcgcaagtggtccagcaagggaaat
gacatcattgcggcagccaagaggatggcgttgctgatggctgagatgtcccggttggta
cgtggcggcagcggtaataagcgagctatgatccagtgtgctaaagacattgccaaagcc
tcggatgaggtcaccaggttggccaaagaggtggccaagcagtgtactgaccgacgcatc
agaaccaacctgctgcaggtgtgtgagcgtatccccaccatcagtactcagctgaagatc
ctgtcaacagtcaaagccaccatgctgggacgaaccaacatcagcgaggaggagtctgaa
caagctacagagatgctggtccataatgcccagaacctgatgctgtcagtcaaggagacc
gtgagagaggccgaggctgcttcaatcaagatccgcaccgatgcaggcttcaccctgcgc
tgggtccgcaagaccccctggtaccagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257962
Entry
112257962         CDS       T05605                                 

Gene name
vcl
Definition
(RefSeq) vinculin isoform X1
  KO
K05700  vinculin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112257962 (vcl)
   04520 Adherens junction
    112257962 (vcl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112257962 (vcl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112257962 (vcl)
   04147 Exosome [BR:otw04147]
    112257962 (vcl)
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112257962 (vcl)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112257962 (vcl)
SSDB
Motif
Pfam: Vinculin Mob_Pre Flavodoxin_1 LIM_bind
Other DBs
NCBI-GeneID: 112257962
NCBI-ProteinID: XP_024287705
LinkDB
Position
1
AA seq 1068 aa
MPVFHTKTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTGPVAAVQAAVSNLVRVGKD
TVQTTEDQIMKRDMPPAFIKVETACTKLVQAASMLKADPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVESMEDLITYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISGIKIFVTTKTSGSQGVEESLKNRNFTFEKMSAE
INEIIRVLQLTSWDEDSWANKKDTEAMKRALALIDSKMTQAKSWLRDPNAQQGDAGEQAI
RQILDEAGKVGELCAGKERRDILGTAKTLGQITDLVSEMRARGQGASPAAMQKAQQVSQG
LDILTGKVENAARKLEAMTNSKQVIAKKIDAAQNWLADPNGGPEGEENIRAILTEAKKIA
DMCEDPKERDDILRSIGEMAALTAKLSELRRQGRGDTPEARTLAKQIATALQNLQSKTTK
AVANSRPAKAAVHLEGKIEQAQSWMENPTIDDGGVGQAAIRGLVAEGRRLANALPGPYRQ
ELLGKCEQVEQLMAQLANLAARGEGESPQARAVAQQLQETLKDLKEKMQEAMTHEVSDIF
SDTTTPIKLLAVASTAPSDAPNRDEVFDERAANFENHANKLGATAEKAAAVGTANKTTVE
GIQAAVKSTRDLTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDT
KSLLNASEEAIKKDLDKCRVAMANHQPQMLVAGATSIARRANRILLVAKREVENSEDPKF
REIVKAASDELSRTISPMVMDAKAVAGNITDPSLQKGFMDSGYRILGAVAIVRDAFQPQE
PDFPPPPPPDLHQLHVSDEPAPPKPPLPEGEVPPPRPPPPEEKDEDFPEQVLGEMVSEPM
MMAARQLHEEARKWSSKGNDIIGAAKRMALLMAEMSRLVRGGSGNKRALIQCAKDIAKAS
DEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISEEESEQ
ATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLHWIRKTPWYQ
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgccggtttttcacacaaagacgatagaaagtatcctagagccggtggctcagcagata
tcccacctggtgataatgcacgaagaaggtgaagtggacgggaaagctatcccggatctc
accggacccgtggctgcagtgcaggcggctgtcagcaacctggtccgggtggggaaagac
actgtccagactacagaggaccagatcatgaagagagatatgcctccagctttcatcaag
gtggagactgcatgcaccaagctggtgcaggcagcatctatgttgaaagcagacccttac
tccgtccccgctcgagattacctcatcgacggctcccggggcatcctctctggcacatcg
gacctgctgctgaccttcgacgaggctgaggttcgtaaaatcattcgcgtctgcaaaggt
atcctggagtacctaaccgtggcagaggtggtggaatctatggaggacctgatcacatac
acaaagaacctgggtccagggatgacaaagatggcaaagatgattgacgagcgacagcag
gagctgacccaccaggaacaccgtgtgatgctggtcaactccatgaacacagtcaaagag
ctgctgcctgtactcatctcaggtatcaagatctttgtgacgaccaagacgtccggcagc
cagggagtagaggagtctctaaagaacaggaacttcaccttcgagaagatgagcgctgag
atcaacgagataattagggtgctgcagctcacttcctgggacgaagactcctgggccaat
aagaaggatacagaggccatgaagagagctctggcactcatcgactctaagatgacccag
gccaagagctggctgagggatcccaatgcccaacaaggggatgcaggagaacaggccatc
cgtcagatcctggatgaggcggggaaggtgggagagctgtgtgctgggaaggagaggagg
gatatcctgggcactgccaaaactctgggccagatcactgacctggtgtctgagatgagg
gccaggggtcagggggcatctcctgcagccatgcagaaggcccaacaggtctcccagggc
ctggacattctcacgggaaaggtggagaacgcagcccggaaattggaggccatgaccaac
tccaaacaggtcatcgccaagaagatcgacgctgctcagaactggctcgcagaccccaac
ggtggtcctgagggagaggagaacatccgagccatcctgactgaggccaagaagatcgct
gacatgtgtgaagaccccaaggagagagatgacatcctgaggtccatcggagagatggct
gctctcaccgccaagctctctgagctccggagacagggtagaggagatactccggaggcc
aggacattggccaaacagatagccacggctctgcagaacctgcagtcgaagaccaccaag
gctgtagccaacagcaggcctgctaaggcagcagtccacctggaagggaagatagaacag
gcccagagctggatggagaaccctaccattgatgacggtggagtgggccaggcagctatc
cggggtctggtggcggagggtcgtcgtctggctaacgccctgccaggtccctatagacag
gagctgctggggaagtgtgagcaggtagaacagttgatggcccagctagccaacctggct
gccaggggcgagggagagtcgccacaagcacgtgccgtggctcagcagctccaggagacc
ctgaaggacctcaaagaaaagatgcaggaagctatgactcacgaagtgtcggacatcttc
agcgacacgaccactcccatcaaactactcgctgtggcctccaccgccccgtccgatgcc
cctaacagggacgaggtgtttgacgagagggcggccaactttgagaaccatgccaacaag
ctgggtgccacggcagaaaaggctgccgctgtaggaacagctaacaagaccactgtggag
gggatccaagctgccgtcaagtctacaagggacctgacaccacaggtggtctctgcagcc
cgtatcctgctgagaaacccaggcaaccaggctgcatacgagcactttgagaccatgaag
aaccagtggattgacaacgtggagaaaatgacaggtttggtggacgaggccatagacacc
aagtctctgttgaatgcctctgaggaggccattaagaaagacctggataagtgtcgtgtg
gccatggctaaccaccagccccagatgttagtggcaggggcaactagcatcgcccggcgg
gccaaccggatcctcctggtggcgaaacgggaggtggagaactctgaggatcctaagttc
agggagatagtgaaggctgcatctgatgagcttagccggaccatctctcccatggtgatg
gacgccaaggctgtggctgggaacatcacagatccaagtctgcagaagggtttcatggac
tcaggttatcgaatcctgggtgccgttgccattgtgagagatgccttccagccacaggaa
ccagacttcccaccaccaccacctcctgatctgcatcagctgcacgtcagcgacgagccc
gccccacccaaaccccctctccccgagggtgaggttcctccccccagaccccctccccca
gaggagaaggacgaggacttcccagagcaggtattgggagagatggtgagcgagcccatg
atgatggccgccaggcagctccacgaggaggcccgcaagtggtctagcaagggtaacgat
atcatcggtgcagccaagagaatggccctgctcatggctgagatgtcccgtctggtgcgc
ggtggcagtgggaacaagcgtgccctcatccagtgtgccaaagacatcgccaaggcctca
gatgaggtcacaaggctggccaaggaggtggccaagcagtgcacagacaaacgcatccgg
actaacctgctccaggtgtgtgagcggatccccaccattagcacacagctcaagatcctc
tccacagtcaaggccaccatgttgggtcgtaccaacatcagtgaagaggagtcagagcag
gccacagagatgttggttcacaatgcccagaacctgatgcagtctgtgaaggagacggta
agagaggctgaggctgcttccatcaagatccggacagatgcaggcttcactctccactgg
atccgtaagacaccctggtaccaataa

DBGET integrated database retrieval system