KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239880
Entry
112239880         CDS       T05605                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04210  Apoptosis
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04623  Cytosolic DNA-sensing pathway
otw04625  C-type lectin receptor signaling pathway
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112239880
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112239880
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112239880
   04621 NOD-like receptor signaling pathway
    112239880
   04622 RIG-I-like receptor signaling pathway
    112239880
   04623 Cytosolic DNA-sensing pathway
    112239880
   04625 C-type lectin receptor signaling pathway
    112239880
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112239880
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112239880
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112239880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112239880
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   112239880
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 DUF2576
Other DBs
NCBI-GeneID: 112239880
NCBI-ProteinID: XP_024264040
LinkDB
Position
Unknown
AA seq 429 aa
MEKRAEENEQMMLHSLPSERGNGFLQLLKSHKEKLDEGMTDLRLRNEELEKERDEGKRER
DCLRRSVEELKTKLVQAQSCGVTEETVQHSEAPPPSDSSHLAKLTEQLQATQCRYRELQE
KLDSLQKSSAQRDRTEVLLKQKDKDCAQLAKDVEALKAQVTSLLGELRERQSCLDQSQQD
RNILDDKLSSTREALAASEREMEQQRKQHSVTVDKLLLQTHNLETALKTDRLVITEERRK
LAQLQHAYTCLFKDYDSKLKTEGGDMVVRLEEAERALALKQDLIDKLKEEVEQQRGSLET
VPVLTAQAEIYKADFLAEREAREKLNQRKEELQDHLNKALAEMERLKQEGTSRARMEEMQ
QRHLEDFIPRPNIPPQPGVAFNTVPPPSSFRSVGLAAGVAGGVSGGGAEELPDYRCPKCQ
YQAPDMDTL
NT seq 1286 nt   +upstreamnt  +downstreamnt
atggagaagagagcagaggagaatgaacagatgatgctccacagcttgccctcagaacga
gggaacgggtttctccagctgctgaagagccacaaagagaagttggatgaagggatgaca
gatctgaggttgaggaatgaagagctggagaaagagagggatgagggaaagcgggagaga
gactgccttcgtcgctcagttgaggaactcaaaaccaagctggttcaggcgcagagctgt
ggtgttaccgaggaaacggttcaacattccgaagcccctcccccatctgacagctcccac
ctggccaaactcacagagcagctacaagccacacagtgcaggtacagagagctgcaggag
aagttagattccctccagaagagttcagctcagagagacagaactgaagtgctgcttaaa
cagaaggacaaagactgtgcccagctggctaaggatgtcgaggcgctgaaggcccaggtg
acgtctcttctgggtgagctgagagagagacagagctgtctggaccagagtcagcaggac
cgcaacatactggacgacaagctgagcagtactcgggaggcgttggcagcatcagagaga
gagatggaacaacagaggaagcagcactctgtgacggtagacaaactactgctgcagaca
cacaacctggagaccgccctgaagactgaccgcctggttattactgaggagaggaggaag
ctagcccagctgcagcacgcctacacctgtctgtttaaggactacgactccaaactcaag
actgagggaggagacatggttgttcgtctggaggaggcagagagagctctggctctgaaa
caggatctgattgacaagctgaaggaagaggtggagcaacagagaggatctctagagacc
gttcctgttctcactgcccaggctgagatctacaaggcagacttcctagcggagcgggag
gccagagagaagttgaaccagaggaaggaggagcttcaggaccatctgaacaaagcactg
gctgagatggagcgtctgaaacaggaggggacctcacgggctcgtatggaggagatgcag
cagagacacctggaggacttcataccacgacccaacatccccccacaaccaggggttgcc
tttaacacggttcctcccccttcctccttccgcagcgtgggattggctgcaggagtggca
gggggtgtctctggaggtggggctgaagagcttcctgactaccgctgtccaaagtgccag
taccaagcccccgacatggacacact

DBGET integrated database retrieval system