KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240763
Entry
112240763         CDS       T05605                                 

Definition
(RefSeq) ubiquitin-like protein ATG12
  KO
K08336  ubiquitin-like protein ATG12
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04136  Autophagy - other
otw04140  Autophagy - animal
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112240763
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112240763
   04136 Autophagy - other
    112240763
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112240763
   04622 RIG-I-like receptor signaling pathway
    112240763
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112240763
   04121 Ubiquitin system [BR:otw04121]
    112240763
   03029 Mitochondrial biogenesis [BR:otw03029]
    112240763
Membrane trafficking [BR:otw04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    112240763
Ubiquitin system [BR:otw04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   112240763
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112240763
SSDB
Motif
Pfam: APG12 Atg8
Other DBs
NCBI-GeneID: 112240763
NCBI-ProteinID: XP_024264772
LinkDB
Position
Unknown
AA seq 120 aa
MSDNAESPTETQKDEPSTPQQPTEDLGTADEKKKIDVLLKAVGDTPIMKTKKWSVEKGRT
VQSLSQFISRFLKMEANEQLFIYVNQSFSPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtctgacaacgcagagtctcctacagaaacgcaaaaagatgagccttcaaccccacaa
cagcctacggaagacttggggacggcagacgagaagaaaaaaattgatgtgttgttgaag
gcagtaggagacacccccatcatgaagacaaagaaatggtctgtagagaaagggaggacc
gtgcaatcactctctcaattcatctctcgattcctcaagatggaggccaatgaacagctg
ttcatttacgtcaaccagtcattctctccctcgcctgatcaggaagtaggagtcctgttt
gaatgttttggcagcgatgggaagcttgttctacattactgtaaatctcaagcctggggt
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112247686
Entry
112247686         CDS       T05605                                 

Definition
(RefSeq) ubiquitin-like protein ATG12
  KO
K08336  ubiquitin-like protein ATG12
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04136  Autophagy - other
otw04140  Autophagy - animal
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112247686
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112247686
   04136 Autophagy - other
    112247686
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112247686
   04622 RIG-I-like receptor signaling pathway
    112247686
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112247686
   04121 Ubiquitin system [BR:otw04121]
    112247686
   03029 Mitochondrial biogenesis [BR:otw03029]
    112247686
Membrane trafficking [BR:otw04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    112247686
Ubiquitin system [BR:otw04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   112247686
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112247686
SSDB
Motif
Pfam: APG12 Atg8
Other DBs
NCBI-GeneID: 112247686
NCBI-ProteinID: XP_024272268
LinkDB
Position
Unknown
AA seq 120 aa
MSDNAESPTETQKDEPSTPQQPTEDSGMADDKKKIDVLLKAVGDTPIMKTKKWSVEKGRT
VQSLSQFISRFLKMEANEQLFIYVNQSFSPSPDQEVGVLFQCFGSDGKLVLHYCKSQAWG
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtctgacaacgcagagtctcctacagaaacgcaaaaagatgagccttcaaccccacaa
cagcctacagaagactcggggatggcagacgataagaaaaaaattgatgtgttgttgaag
gcagtaggagacacccccatcatgaagacaaagaaatggtcggtagagaaagggaggaca
gtgcaatcactctctcaattcatctctcgattcctcaagatggaggctaatgaacagctg
ttcatttacgtcaaccagtcattctctccctcgcctgatcaggaagtaggagtcctgttt
caatgttttggcagcgatgggaagcttgttctacattactgtaaatctcaagcctggggt
taa

DBGET integrated database retrieval system