KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240902
Entry
112240902         CDS       T05605                                 

Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04210  Apoptosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112240902
  09143 Cell growth and death
   04210 Apoptosis
    112240902
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112240902
   04520 Adherens junction
    112240902
   04530 Tight junction
    112240902
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112240902
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112240902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112240902
   03019 Messenger RNA biogenesis [BR:otw03019]
    112240902
   03036 Chromosome and associated proteins [BR:otw03036]
    112240902
   03029 Mitochondrial biogenesis [BR:otw03029]
    112240902
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112240902
   04147 Exosome [BR:otw04147]
    112240902
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     112240902
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     112240902
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     112240902
    NuA4 complex
     112240902
  Chromatin remodeling factors
   BAF complex
    112240902
   PBAF complex
    112240902
   SWR1 complex
    112240902
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    112240902
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     112240902
Exosome [BR:otw04147]
 Exosomal proteins
  Proteins found in most exosomes
   112240902
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 112240902
NCBI-ProteinID: XP_024264891
LinkDB
Position
Unknown
AA seq 375 aa
MEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagatgaaatcgccgccctggtcgttgataacggctccggtatgtgcaaggccggt
ttcgcaggagatgatgctcctcgggctgtgttcccctccatcgtgggtcgccccagacat
cagggagtgatggttgggatgggccagaaggacagttacgtgggagacgaggctcagagc
aagaggggcatcctgactctgaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcatcacaccttctacaacgagctgagagtggctccagaggag
caccccgtcctgctcactgaggcccccctcaaccccaaagccaacagggagaagatgacc
cagatcatgtttgagaccttcaacacccctgccatgtacgtggccatccaggccgtgttg
tccctgtacgcctccggccgtaccaccggtatcgtcatggactccggtgacggcgtgacc
cacacagtacccatctacgagggctacgctctgccccacgccatcctgcgtctggatctg
gccggccgcgacctcactgactacctgatgaagatcctgacggagcgcggctacagcttc
accaccacygccgagagggaaatcgtacgagacatcaaggagaagctgtgctacgtggcg
ctggactttgagcaggagatgggcaccgctgcctcctcttcctctctggagaagagctac
gagctgcctgacggacaggtcatcaccatcggcaacgagaggttccgctgcccagaggcc
ctcttccagccctccttcctcggtatggagtcttgcggtatccacgagaccaccttcaac
tctatcatgaagtgtgacgtggacatccgtaaggacctgtacgccaacactgtgctgtcc
ggaggaaccaccatgtaccccggcatcgctgacaggatgcagaaggagatcacctctctg
gccccctccaccatgaagatcaagatcatcgcccctccagagcgtaaatactccgtctgg
atcggaggctccatcttggcttctctctccaccttccaacagatgtggatcagcaagcag
gagtacgacgagtctggtccctccatcgtccaccgtaaatgcttctaa

DBGET integrated database retrieval system