KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241165
Entry
112241165         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04080  Neuroactive ligand-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112241165
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112241165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112241165
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    112241165
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 112241165
NCBI-ProteinID: XP_024265091
LinkDB
Position
Unknown
AA seq 372 aa
MDKLTDDVPGCYYNRTVQFFYEHSGKNISAHWRPRDYVVVSLGMGVSVIVILANILVMVA
IFINRRFHFPIYYLLGNLAAADLFSGIAYLHLMFHTGPWTIKLSKNYKFTSQHLIDSSLT
ASVLNLLAIALERHQTIFTMQLHSKMTKRRVVLLIALIWGLAIFMGLVPTMGWHXVCDLE
NCSTMAPMYKRSYLVFWAVLNLFTFSLMVAAYTRIFVYVRHKPGMSQHTSQIRHKETVFN
LMKTVSRLVYLGCFVICWTPGLVLLMLDGLGCESCQVLRYEKYCLVLAECNSLVNPIIYS
FRDTDMLQTFKRILCCLCRRGDAGRKDTLSGMRCNTLEQEVLSESNGNNHHDNHNDDKNH
ISPHGDHSDTDD
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggacaagttgacagacgatgtccccgggtgctactacaaccgtacagtgcagttcttc
tacgaacatagtggcaagaacatcagcgcccactggcgtcctcgggactacgtggtggtg
agcctgggcatgggtgtgtctgtcatcgtcatcctggccaacatcctggtcatggtggcc
atcttcatcaaccgacgattccacttccctatctactatctgctaggcaacctggcggca
gcagacctgttctcaggtatcgcctacctgcacctgatgttccacactgggccctggacc
atcaagctgtccaagaactacaagtttaccagtcagcacctgatcgactccagtctgaca
gcatcggtgttgaacctcctggccatcgccttggagcgtcaccagaccatcttcaccatg
cagctccacagtaagatgaccaaacgccgtgtggtgctgctcatcgcccttatctggggc
ctagccatcttcatgggcctggttcccaccatgggctggcacntggtgtgtgacctggaa
aactgctccaccatggcccccatgtacaaacgctcctacctggtgttctgggctgtgctc
aacctgttcaccttctctctcatggtggctgcctacaccaggatctttgtgtacgtcaga
cacaagccagggatgtctcagcacaccagccagatacgacacaaggagactgtgttcaac
ctgatgaagacggttagtaggttagtgtacttaggttgttttgtgatctgctggaccccg
ggcctggtgttgttgatgttggatggtctgggctgtgaatcttgccaggtgctgcgttat
gagaagtactgtctggtcctggctgagtgtaactccctggtcaaccccatcatctacagc
ttcagagacacggacatgttacagaccttcaagcggatcctctgctgcctgtgtcgccgc
ggcgacgctggccgcaaagacacgctgtccggcatgcgctgcaacaccctggagcaagag
gtactctccgagagcaacggcaacaatcaccacgacaaccacaacgacgacaaaaatcat
ataagtccccacggcgaccactcggacacagacgattag

DBGET integrated database retrieval system