KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241489
Entry
112241489         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112241489
   04350 TGF-beta signaling pathway
    112241489
   04068 FoxO signaling pathway
    112241489
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112241489
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112241489
  09143 Cell growth and death
   04218 Cellular senescence
    112241489
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112241489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112241489
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112241489
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112241489
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ecTbetaR2 DcuC SIT
Other DBs
NCBI-GeneID: 112241489
NCBI-ProteinID: XP_024265363
LinkDB
Position
Unknown
AA seq 439 aa
MTNILNMIGCVSPDGMFQPSFSLNKLCKFCDVESSSCNGTGSCLSNCSITSICRLEQEVF
AHLEEELAGPLFICFCTEEECNDNLAFAPVVGPTIEPPVVSIVLISLLPLLVLVVVVITM
FYWYRVQRHRKLSQKQWDSKKSKRKGLDCSIMMDDDGSDSSSTHANNLNHNTEPLPIELD
LQVGKGRFAEVFKAKLRQPGSSSDQYETVAVKIFPEEEYASWKNEKDIFSDIDLRHDNVL
HFLTAEERKMSKQYWLITAFHPRGNLQEYLTRNLVSWEDLRGLGGSLACGVAHLHSDHTA
CGRPKVPIVHRDLKSSNILVKQDLTCCLCDFGLGLRLDNTMTVDDLANSGQVGTARYMAP
EVLESRLNLENIESFKQTDVYSMALVLWEITSRCHAIGGTLTHSLTHSLTHSLTHSFTYT
HTHTLTHRVTDTLTHTLTE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgacaaacatattgaatatgattggttgtgtttctccagatgggatgttccagccgtcc
ttcagtctcaacaagttgtgtaagttctgtgacgtggagtcttcatcctgcaacggaaca
ggaagctgcctctcaaactgctccatcacctccatctgtcgtctggagcaggaagtcttc
gcgcatctagaagaagagcttgcgggaccgttgttcatctgcttctgtactgaggaggag
tgtaacgataacctggccttcgctcccgtggtcggcccgacaatcgagcccccggtggta
tcgatcgtcctgatcagcctgttgcccttactggtcctagtggtagtagtcatcactatg
ttctattggtaccgggtccaacgccatcgcaaactcagccagaaacaatgggacagcaag
aagtccaaacgcaaaggtctggactgcagcatcatgatggacgacgatggatcagacagc
agctcaacgcacgccaacaacctcaaccacaacactgaacccctacccatcgagctggac
ctgcaggtgggtaaggggcgcttcgctgaggtgttcaaggccaagctgaggcagcccggc
tcctcgtctgaccagtatgagacggtggccgtgaagatcttccctgaggaagagtacgca
tcgtggaagaacgagaaggacatcttctctgacatcgaccttcgccacgacaacgtcctc
cacttcctcacagcagaggagagaaagatgtcgaagcagtactggctgatcacagccttc
cacccccgaggaaaccttcaggagtacctgacccgtaacctggtctcctgggaggatcta
cggggtctgggcgggtccctggcctgcggggtggcacaccttcacagtgaccacacggcc
tgcgggcgacccaaagtgcccatcgtacaccgcgacctgaagagctctaacatcctggtg
aagcaggatctgacctgttgtctgtgtgactttggactggggctcagactggataacacc
atgacagtggatgatctcgcaaacagcggacaggtgggcacagccaggtacatggctcct
gaagtgttggagtccaggctgaacctggagaacattgagtcgttcaagcagacagatgtt
tattctatggctctggtgttgtgggagatcacctcccgctgtcatgccatcggaggtaca
ctcacccactcactcactcactcactcactcattcactcactcactcattcacttacaca
cacactcacacactcactcacagagttacagacacactcacacacacactcacagagtaa

DBGET integrated database retrieval system