KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112242788Help
Entry
112242788         CDS       T05605                                 

Definition
(RefSeq) uncharacterized protein LOC112242788
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_2 GST_C_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 112242788
NCBI-ProteinID: XP_024266413
LinkDB All DBs
Position
Unknown
AA seq 203 aa AA seqDB search
MKLYYSPGACSLSPHIALREAGLNFELVQVDLASKKTASGQDYLEINPFGYVPCLQLDDG
RMLAEGPAILQYVADQVPGKLLAPANGSFERYHLQQWLNFISTELHKSFSPLFNPAASED
WKNAVRQTLNARLGQVARQLERAPYLLGDRLSVADIYLLVVLGWGAYVNLDLSPWPALQA
FMGRVGGREAVQAALRAEGLIKG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttactacagtcctggcgcctgctccctgtcaccgcacattgcgttgcgcgag
gcgggcctgaacttcgagttggtacaggtcgatctggcgagcaagaagactgcctccggg
caggactaccttgaaatcaacccgttcggctacgtgccttgtctgcagcttgacgacggc
cgcatgctggccgaaggccccgccatcctgcaatacgtggccgatcaggtgcccggcaag
ctactggcgccggccaacggcagctttgagcgctaccacttgcagcaatggttgaacttc
atctcgaccgaactgcacaagagcttcagcccgctgttcaaccctgccgccagcgaggac
tggaaaaacgcggtgcggcagaccctgaacgcccggctggggcaagtggcgcggcaactc
gagcgtgcgccttatctgctgggcgatcgattgagcgtggctgacatctatctgttggtc
gtgctcggttggggcgcctatgtcaaccttgatctttcgccctggcccgcgctgcaggcc
ttcatgggccgagtcggaggccgcgaagcggtgcaggcagcactgcgagccgaaggcttg
atcaagggctga

DBGET integrated database retrieval system