KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112244930
Entry
112244930         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein G1-like
  KO
K09385  forkhead box protein G
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112244930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112244930
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    112244930
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 112244930
NCBI-ProteinID: XP_024268588
LinkDB
Position
Unknown
AA seq 412 aa
MLDMGERKEVKMIPKSSFSINSLVPEAVQSDNHHRTVHEEEEKIPLPTLVQDPKSENICT
KIENSSNETTCTDEKEKQEEKKDSKEGESGGKDGEKKNGKYEKPPFSYNALIMMAIRQSP
EKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLD
PSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHH
PRASSALSYNGTSSPYPSHPMSYSTMLTQNSLGNNHSFPSSNGLSVDRLVNGDIPYATHH
LTAAALAASVPCGLSVPCSGTYSLNPCSSINLLAGQTSYFFPHVPHPSMTSQSSASMAAR
VASSSSSPQAPSSLPCESLRSSLPSFSSGLSGGLSDYFTHHNQGSTSNPLIH
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgttggatatgggagaacggaaagaagtgaaaatgattcctaaatcatcgttcagtata
aacagtctggtgcctgaagccgtccaaagtgacaaccaccacagaaccgtccacgaggaa
gaggagaagattcctttacctaccctggtgcaggacccaaagtcggagaacatttgcacc
aaaatcgaaaattcgtccaatgaaacgacttgcactgacgagaaggaaaaacaggaagag
aagaaggatagcaaagagggggagagcggtgggaaagatggtgaaaagaaaaacggcaag
tacgagaaaccaccatttagctataatgctttaattatgatggctattcggcagagtccg
gagaaacgactaactctgaacggtatttacgagttcattatgaagaatttcccctattac
cgggagaacaagcagggttggcagaattccatcaggcataacctcagcctaaacaaatgt
tttgttaaagtcccgcggcactatgatgacccgggtaaggggaactactggatgcttgac
ccctcgagtgacgatgtgtttatcggtgggacaaccggcaaacttcgtaggagatcgacc
acatccagggcaaagttggcttttaagcgaggcgctcgccttacttccacggggttgacc
tttatggatagagccggctctctatattggccaatgtcaccgtttctttcgcttcaccat
ccgagggccagcagcgcgttgagctacaatgggacatcatcgccataccctagtcatcct
atgtcctacagtacaatgttgactcaaaacagtttggggaacaaccattctttcccttct
tccaatggcctgagtgttgacagacttgtgaatggagacattccctatgccactcatcac
ctaacggcggcggcgttggcggcctctgtgccatgtggtctatccgtgccctgctccggg
acttactctttaaacccatgttcgtccataaacctccttgcaggacagacaagttacttt
ttcccccatgtcccgcatccatcaatgacctcccagagcagcgcttcgatggcggccagg
gttgcctcctcctcctcctccccgcaggcgccatcatctcttccctgtgagtccttaagg
tcttctctaccaagtttctcttctggactttctggaggactttctgattacttcacacat
cataatcaagggtcaacttcaaatccacttatacactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253136
Entry
112253136         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein G1-like
  KO
K09385  forkhead box protein G
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112253136
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112253136
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    112253136
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 112253136
NCBI-ProteinID: XP_024280863
LinkDB
Position
6
AA seq 352 aa
MGDQKEPPMVHRSTSFSIKSLLLPSKCDKQDSVLPEKNTVSSGSDSEKSLDPDMESAPLN
PEKPKEDDEGTERATEPSKNGKYDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFP
YYREHKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR
SATSRGKLAMKRGLRFAPLSLGINDRANNPLYWQISPFLSLHHPHYNGSSAGFLNQGHAY
GSLLPGVDQLTNGDLTRHLGGSVGALGLSNSYGVSTSGLLSGQSGYFVSGSQHPPPHLQQ
SAQGYGVPTSSQQTLISNSLRTSLPSFSPGISSGFPGVLSHQKRVTPNAFLN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggagatcagaaagagccgccgatggtgcaccgatctacttcatttagtatcaagagt
ctgctgcttccctcaaaatgtgataaacaggactcggtgctcccagaaaaaaacactgtt
tcttcgggttctgattcggaaaaatctctggatcctgatatggaatctgcacctttgaac
ccagagaaaccgaaggaggacgacgagggtaccgagcgggcgacagagcctagcaagaat
gggaaatatgataaaccgccattcagctacaacgccttgattatgatggctatcagacag
agtcctgagaagagactgactctgaacggtatctatgagtttatcatgaagaacttccca
tattaccgggagcacaagcaaggctggcaaaactctatccgccacaacttgagcctcaat
aagtgttttgtgaaagtgccaaggcattacgacgacccgggcaaagggaactactggatg
ttggacccttcgagcgacgatgtgtttattggtggaactacgggaaaacttcggagacgc
tctgctacgtcaaggggtaaactggcgatgaaacggggactacgctttgcgcctctcagt
ttgggaataaacgacagggcgaacaaccctctgtattggcaaatatctccgtttttatcg
ttgcaccatccccattacaatggatcatctgcaggatttctgaaccaagggcacgcgtat
gggtctctactccccggggtggaccagctgactaacggggaccttacacgccatctaggt
ggatctgtcggtgctctgggtttgtcaaacagttacggtgtaagcacgtctgggctacta
tcgggacagagtggctactttgtctcagggagccagcacccgccgccgcatctccagcag
agcgcgcagggctatggtgtgccgacgagctcgcaacaaacactgatctcgaactctcta
agaacgtccctaccgtctttttcaccgggaatttctagcgggtttccaggagtgttgtcc
catcaaaagagggtcactccaaatgctttcttaaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255550
Entry
112255550         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein G1-like
  KO
K09385  forkhead box protein G
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112255550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112255550
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    112255550
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 112255550
NCBI-ProteinID: XP_024284291
LinkDB
Position
1
AA seq 379 aa
MQCPDPIASYLFLFKHKAQSFFLSVSGMEDQKEPPMVHRSTSFSIKSLLLPSKCDKQDSV
LPEKNTGSSGSDSEKSLDPDMESAPLDREKQKEEDEGTLRATEPSKNGKYDKPPFSYNAL
IMMAIRQSAEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRHNLSLNKCFVKVPRHYDDP
GKGNYWMLDPSSDDVFIGGTTGKLRRRSATSRGKLAMKRGMRFSPLGLGINDRANNPLYW
QISPFLSLHHPHYNGSSAGFLNQGHAYGSLLPGVDQLSNGDLTRHLSGSVGALGLSNSYG
VSTSSLLSGQSGYFVSGSQHQPPHLQQSAQGYGVPTSSPQTLLSDSLRTSLQSFSPGVSS
GFPGMLSHQKRVTPNAFLN
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgcaatgccctgatccaattgcgtcttaccttttcctttttaaacacaaagcccaatca
ttttttttgtcagtgtccggcatggaagatcagaaagaaccgccgatggtgcaccgatct
acttcatttagtatcaagagtctgctgcttccctcaaaatgtgacaaacaggactcggtg
ctcccggaaaaaaacacgggttcttccgggtctgattcggaaaaatcactggatcctgat
atggaatctgcacctttggaccgggagaaacaaaaggaggaagacgagggtaccttgcgg
gcgacagagcctagcaaaaatggaaaatatgataaaccgccattcagctacaacgccttg
attatgatggctatcagacagagtgccgagaagagactgactctaaacggtatctatgag
tttatcatgaagaactttccatattaccgagagcacaagcaaggctggcaaaactctatc
cgacacaacctgagcctcaataagtgttttgtgaaagtgccaaggcattacgacgacccg
ggcaaagggaactactggatgttggacccttcgagcgatgatgtatttattggtggaact
acggggaaacttcggagacgttctgctacctccaggggcaagttggcgatgaaacgtgga
atgcgcttttcgcctcttggtttgggaataaacgacagggcaaacaatcctctgtattgg
caaatctcgccgtttttatcattgcaccatccccattacaatggatcatcagcaggattt
ctgaaccaagggcacgcgtatgggtccctactccccggtgtggaccagctgagtaatggg
gaccttacgcgccatctaagtggatctgtcggtgctctgggcttgtcaaacagttacggt
gtaagcacgtctagtctattatccggacagagtggctactttgtctcagggagtcagcac
cagccgccgcatctccagcagagcgcgcaaggctacggtgtacccacgagctccccacaa
acactgctctcggactcacttcgaacgtccctacagtctttttcaccgggagtttctagc
gggtttccaggaatgttgtcacatcaaaagagggtcactccaaatgctttcttaaattga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256829
Entry
112256829         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein G1-like
  KO
K09385  forkhead box protein G
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112256829
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112256829
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    112256829
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 112256829
NCBI-ProteinID: XP_024286129
LinkDB
Position
8
AA seq 412 aa
MLDMGERKEVKMIPKSSFSINSLVPEAVQSDNHHRTVSEEEGKIPLPSIVQDAKSENICT
KSDNSSNETTCMDEKEKQEEKKDSKEGESGGKDGEKKNGKYEKPPFSYNALIMMAIRQSP
EKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLD
PSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSSGLTFMDRAGSLYWPMSPFLSLHH
PRASSALSYNGTSSAYPSHPMSYSTMLTQNSLGNNHSFPSSNGLSVDRLVNGDIPYATHH
LTAAALAASVPCGLSVPCSGTYSLNPCSSINLLAGQTSYFFPHVPHPSMTSQSSASMAAR
VASSSSSPQAPSSLPCESLRSSLPSFSSGLSGGLSDYFTHHNQGSTSNPLIH
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgttggatatgggagaacggaaagaagtgaaaatgattcctaaatcatctttcagtata
aacagtctggtgcctgaagccgtccaaagtgacaaccaccacagaaccgtgtcagaagaa
gaggggaagatccctttaccttctatagtgcaagatgcaaagtcagagaacatttgcacc
aaaagtgacaattcgtccaatgaaaccacttgcatggacgaaaaggaaaaacaggaagag
aagaaggatagcaaagagggagagagcggtgggaaagacggtgaaaagaaaaacggcaag
tacgagaaaccaccattcagctataatgctttaattatgatggctattcggcagagtccg
gagaaacgactaactctgaacggtatttacgaattcattatgaagaatttcccctattac
cgggagaacaagcagggttggcagaattccatcaggcataaccttagcctaaacaaatgt
tttgttaaagtcccgaggcactatgatgacccgggtaaggggaactactggatgcttgac
ccctcgagtgacgatgtgtttatcggtgggacaacaggcaaacttcgccggaggtcgacc
acatccagggcaaagttggctttcaagcggggtgctcgtcttacttcctctgggttgacc
tttatggatagagccggctctctatattggccaatgtcaccatttctttcgcttcaccat
ccgagggccagcagcgcattgagctacaatgggacatcatcggcttaccctagtcatcct
atgtcctacagtacaatgttgactcaaaacagtttggggaacaaccattctttcccttct
tccaatggcctaagtgttgacagacttgtgaatggagacattccctatgccactcatcac
ctaacggcggcggcattggcggcctctgtgccatgtggtctatcagtgccctgctccggg
acatactctttaaacccatgttcgtccataaacctccttgcaggacagacaagttacttt
ttcccccatgtcccgcatccatcaatgacctcccagagcagcgcttcgatggcggccagg
gttgcatcctcctcctcctccccgcaggcgccctcatctcttccctgtgagtctttaagg
tcttcgctaccaagtttctcttcaggactttctggaggactttctgattacttcacacat
cataatcaagggtcaacttcaaatccacttatacactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265972
Entry
112265972         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein G1-like
  KO
K09385  forkhead box protein G
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112265972
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112265972
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    112265972
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 112265972
NCBI-ProteinID: XP_024299251
LinkDB
Position
13
AA seq 435 aa
MLNMEDLKAPVRFFNKSSFSISSLLFRREGVMSDDGAALDGILSGCSKPLSRKHISSGLS
ARPKEVSAQDRKYDLHRDKNCDNKEYAVQEDKRVSRNGKREDGEDTERVGEVKTCGGVEG
KDKPEKPPFSYNALIMMAISQSPERRLTLNGIYEFIIGNFPYYRENRKGWQNSIRHNLSL
NKCFVKIPRHYDDPGKGNYWMLDPSSENMFIAGTTGKLRCRSTAGTRAKLEIKRDSRLTT
TAAGLAFTGSFYWPVPSFLNLQHPAHSYPGTGSYVGPHQSNYATSILSQRSHHTTVSAIN
ARADRIFQTNQESSYVGMGGDAQYCRHHQMSAATTFASSSLPCTLSLANPCSFNLLSGQA
SYFYSHHQVPHPVTFNAWCQEEYPSSKASPAGHIYSGKNGPSDCLGSLCMEFPNYFLPSS
HTSTLNTNLSWDAGK
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgttgaatatggaggatttgaaagcccctgtcagatttttcaacaagtcttcattcagc
atcagcagcctgctgtttcgacgagagggagtgatgagtgacgacggcgccgcactggat
gggatcctttccggatgctccaagcccctttccagaaaacacatttcttcgggtctatct
gctaggcctaaagaagttagtgctcaagatagaaaatatgatttacatagagacaaaaac
tgtgataataaagaatacgccgtccaagaggacaaacgagtctccagaaatggcaaaaga
gaagacggagaagatacggagagagttggagaggtgaagacatgtggaggagtagaggga
aaagacaaaccggagaaacctcctttcagctataacgctctgataatgatggctattagc
cagagcccggagcgaaggcttaccctcaacggcatttatgagttcatcataggtaatttc
ccttactatcgagaaaatagaaaaggatggcagaattccatccgacataacctgagtctg
aacaagtgctttgtcaaaatacctcgccattatgatgacccaggcaaaggcaactactgg
atgcttgacccttcaagtgagaacatgttcatagctggcacaactggtaaactccggtgc
cgttccacggcgggcacccgggcaaagttggaaattaaacgggattcgcgtttgaccacc
actgccgccgggctggcgttcactgggtcattttattggccggtgccatcgtttctaaac
cttcaacatcctgcgcactcatacccgggcacagggtcatatgtagggccccatcagtcc
aactatgccacctcgatcctttctcaacggtcacaccacaccaccgtgagtgccataaat
gctagggcagaccgaatcttccaaacaaaccaagagtcgtcttatgttggcatgggtgga
gatgcgcagtactgtcgccatcaccaaatgagcgcagccacaacattcgcctcttcatcg
ttgccatgcactttgtctctcgctaacccttgttcctttaacctgctctccggacaagcg
agttatttttactcgcatcaccaggtaccccacccggtgacgttcaatgcatggtgccag
gaggagtacccctcatccaaggcatctcctgccggacacatttactccggaaagaatgga
ccatcggattgcttggggagtttatgcatggagttccctaattattttcttccaagtagc
cacacgagcaccctcaacaccaatctttcttgggatgcagggaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267175
Entry
112267175         CDS       T05605                                 

Definition
(RefSeq) forkhead box protein G1-like
  KO
K09385  forkhead box protein G
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112267175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112267175
Transcription factors [BR:otw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    112267175
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 112267175
NCBI-ProteinID: XP_024301127
LinkDB
Position
14
AA seq 426 aa
MLNMEDLKAPVRFFHKSSFSISSLLFRREGVMSDDGAVLDGHLSRKHISSGPSTRPKEVC
AQDGTYDLHGDKNCHKEYAVQEDKRLSRNGKREDGEDTDGVGEVKTSGGVEGKAKPEKPP
FSYNALIMMAIRQSPERRLTLNGIYEFIMGNFPYYQENRQGWQNSIRHNLSLNKCFVKVP
RHYDDPGKGNYWMLDPSSEDVFIGGTTGKLRRRSTAGTQTKLAIKRGARLTSTTAAGLAF
TGSFYWPVPSFLNIQPPANSHSGMGSCVGPNHSNYATSILSQRSHHMSAINAGADRLFQT
NQESSYFGMGAGAQYRRHHQMSAATTFASSSLPCTLSLPNPCSFNLLNRQASYFYSHHQV
PHPATFNTWCQDEYPSTKASPAGPIYSGKNGPSDCLGSLCAEFPNYFPSISPMSSLNTNL
SWDAGK
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgttgaacatggaggatttgaaagctcctgtcagatttttccacaagtcttcattcagc
atcagcagcctgctgtttcgacgagagggagtgatgagtgatgacggtgccgtgctggat
gggcatctttccagaaaacacatttcttcggggccatctactaggcctaaagaagtttgt
gctcaagatggaacatacgatttacatggagacaagaattgtcataaagaatacgcagtc
caagaagacaaacgactctccagaaatggaaaaagggaagacggagaagataccgatgga
gtgggagaggtgaagacatctggaggagtagagggaaaagctaaaccggagaaacctcct
ttcagctataacgcattgataatgatggctattcgccagagcccggagcgaaggcttacc
ctcaacggcatttacgagttcatcatgggcaacttcccttactatcaagaaaatagacaa
ggatggcagaattcaatccggcataacctgagtttgaacaagtgcttcgtcaaagtacct
cgccattatgatgacccaggcaaaggcaactactggatgcttgacccttcaagcgaggat
gtgttcataggtggcacaactggtaaactccggcgccgttccacggcgggcacccagaca
aagctggcaataaaacggggtgcccgtttgacctccaccactgccgcagggctggcgttc
actgggtccttttattggccggtgccatcgtttctaaacattcaacctcctgcgaactca
cactcgggcatggggtcatgtgtagggcccaatcactccaactatgccacctcgatcctt
tctcaacggtcacaccacatgagtgccataaatgctggagcagaccgactcttccaaaca
aaccaggagtcatcgtattttggcatgggtgcaggcgcgcaataccgtcgtcatcaccaa
atgagcgcagccacaacattcgcctcttcatcgttgccatgcactttgtctctccctaac
ccttgttcctttaacttgctcaaccgacaagctagttatttttactcgcatcaccaggta
ccccacccggcgacattcaatacatggtgccaggatgagtacccctcaaccaaggcatct
ccagccggaccgatttactccggaaaaaatgggccatcggattgcttggggagtttgtgt
gcggagttccctaattattttccctcaatcagccccatgagctccctcaacaccaatctt
tcttgggatgcagggaaatga

DBGET integrated database retrieval system