KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245597Help
Entry
112245597         CDS       T05605                                 

Definition
(RefSeq) polycomb complex protein BMI-1-like
  KO
K11459  polycomb group RING finger protein 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112245597
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     112245597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-C3HC4_4 zf-rbx1 zf-RING_5 zf-Nse zf-RING_UBOX Rad60-SLD PHD_2
Motif
Other DBs
NCBI-GeneID: 112245597
NCBI-ProteinID: XP_024269487
LinkDB All DBs
Position
Unknown
AA seq 333 aa AA seqDB search
MDKMQPSRLKITELNPNLICPLCVGYFIDATTIVECLHSFCKTCIVAFLETNKFCPRCDV
QVHKTCPQLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYTNQENQHLEPGEVVEEPTII
AEDEIISLSIQFHEKNKSDTQPMNTEGDNTNSKRFLQCPAAMTVLHLAKFLRSKMDIPNT
LRIEVLYADEPLKDYYTLMDIAYMYSWRRNGPLPLQYXVKPTRKRRRLSQGAAQAHSDGV
NTSPTSESDSHSDKALSPAGQXPRXSTLPSPAXRGQPSTLQSPSGTTGPNGTQRLPLASK
SGSNARKVNVNGKSNGAATETRGGDKGAVPPPT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatgcaacccagtcggctaaaaatcacagagctgaatcctaacctgatatgc
ccactgtgtgtgggctacttcattgatgccacaaccatcgtggagtgcttgcactcattc
tgcaagacgtgcattgttgccttcctggaaaccaacaagttctgccccagatgtgatgtg
caagtacacaagacatgtccacagctcagcatcaggtcagacaagactctacaggacatt
gtatacaagctggtgcctggattattcaaagatgagatgaaacgaaggcgggacttctac
acaaaccaggaaaaccaacacctggagccaggagaagtggtggaggagccaactattatt
gcagaagatgaaatcatcagtctctccattcagttccatgagaagaacaaaagtgacaca
caacctatgaatacagaaggagacaataccaacagcaaacgcttcctgcaatgcccggca
gccatgaccgtcctgcacttagccaagttcctgcgtagcaagatggacattccaaacacc
ttacggattgaagtgctgtacgctgatgagcccttaaaggactactacacactgatggat
attgcctacatgtattcttggcgacgtaatggccccctccccctgcagtactgkgtcaag
cccacccggaagcgtcgamggctgtcccaaggtgccgcccaggcycactccgacggtgtm
aacacaagccccacctctgagagcgactcccacagcgacaaggccctgagcccggctggt
caggyccccagagyctccaccctgcccagccctgccstccgaggccaaccctctaccctt
cagagccccagcggtaccacaggacccaacggtactcaacggctccctctagcctccaag
tcagggagcaacgcccgcaaggtgaatgtcaacggcaaaagcaatggagcggcgactgag
actaggggaggggacaaaggggctgtaccaccaccaacctaa

DBGET integrated database retrieval system