KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112247305
Entry
112247305         CDS       T05605                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 Adeno_E4_34
Other DBs
NCBI-GeneID: 112247305
NCBI-ProteinID: XP_024271793
LinkDB
Position
Unknown
AA seq 376 aa
MSWGEFIELRELRLHDNDRIELTCCEVPRSPPRLERANALRISPGKVPELLSRVGIIRLL
GDSLDPRLTDERGEGHDFQPCSHAQPTWCDLCGDFIWGLYKQSLRCANCGFTCHYRCRPL
IQLDCSLDRGSTVEQTCAVETDTNVDEQVKCGKQQELSGTEIQQKVKEYNAQINSNLFMN
LNKDGSFTGFIKVQFKLVRPVSVPPPRKGTGTQDGAGKKNGGVKRCTSFYLPKDTSKHLH
ISSRTCAREVIEALLKKFTVVDNPGKFALFERTERHDQVFLRKLSDDERPLELRLCAGPN
EKALSLVLKENETGEVNWDAFSMPELKNFVRMLQREEEEHVKQILQRYTLARTRMQEAQA
AASIPGGSAASGSTPG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtcttggggtgagttcattgagctccgtgagttgaggctgcatgacaatgaccggata
gagctgacctgctgcgaggtgcctcgctcaccacctcgcctggagcgggccaatgccctg
cggatcagcccagggaaggtcccagagctgctcagccgggtgggcatcatccgactgctg
ggggatagcctggacccacggctcacagatgagaggggagagggacatgacttccagccc
tgcagccatgcccagcccacctggtgtgacctgtgtggagacttcatctggggactgtac
aaacagagcctgcgctgtgccaattgcggattcacatgtcactatcgatgtcgacctctc
atccaattagattgcagtttggatcgtggctccacagttgaacaaacatgtgctgtagag
actgatacaaatgtggatgagcaggtcaaatgtgggaagcagcaggagctgtcaggcaca
gagatccagcagaaggtgaaggagtacaatgctcaaatcaacagcaacctctttatgaac
ctgaacaaagatggctccttcactggcttcataaaggtccagttcaagctggtacgacct
gtgtcagttcccccaccgagaaagggtactggaacacaggatggtgcgggcaagaagaat
gggggagtaaaacgttgcacctctttctacctgcccaaggatacatcaaaacacctacac
atcagctcccggacatgcgctcgtgaggtcatcgaagccttgctaaagaagttcactgtg
gtggacaaccctggaaagtttgccctgtttgagcgcaccgagcgtcatgaccaagtgttc
ctacgtaagctgtctgatgacgagcgtccactcgaacttcgtctgtgtgctggacccaat
gagaaagccctcagtttggtattgaaagagaatgagactggagaggtcaactgggatgcc
ttctctatgccagagctcaagaactttgtccgcatgttacagcgtgaagaggaggagcat
gtcaagcagattttgcagcgctacactctggcccgcaccagaatgcaagaggcccaagct
gctgcttccatccctggtggttccgccgctagtggttccacccctggctga

DBGET integrated database retrieval system