KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248400
Entry
112248400         CDS       T05605                                 

Definition
(RefSeq) caskin-1-like isoform X1
  KO
K05760  paxillin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112248400
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112248400
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112248400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112248400
Domain-containing proteins not elsewhere classified [BR:otw04990]
 LIM domain-containing proteins
  Paxillin family proteins
   112248400
SSDB
Motif
Pfam: Paxillin LIM DUF4363
Other DBs
NCBI-GeneID: 112248400
NCBI-ProteinID: XP_024273148
LinkDB
Position
4
AA seq 1196 aa
MDDLDALLADLESTTSHISKHPVFLSEETPYSFPTGGNSYQDVSVPPPVPPPPSAEALNG
SVIDSPDSHHSSQQSLGSAPKSLWSRDSSSPPVSHIEEDHVYSFPNKQKSADQSAAAMSS
ALGSNLSELDRLLLELNAVQQNSPSFPTTEETAPPLPSCSITHYVQENGGPPDVMVSPRS
QEKTKRNGSQAVEEGRPTVESLLDELEGSLPTPSPSVLHNELDSSSQQQARMSASCATRE
LDELMASLSDFKPVLGSLGSMNSDLQLDQAGTSPSIILEVHPPPRTCSSLAAAAPSSLSP
SQPACDSPLFSLPAWELHIEEESGDSGGAVSPPHPSLSSPPPATVTSQSPLSFAESDPEP
KVVIDVSATILKSRQKSLVALNHSNPSLSTYPSPPNAAKPSLNSASVTLDNNPLKSHSSF
LEPCTTPPTVTKSTSPLTDMDLCFSTPTTTKSLSPVPVSTSKTPSPLHASVTKTPSPLHA
SVTKSPPLTASKAPSPSLVASPKSPSPPALTSPKISRRVLEPVPAAEPSLDEALDKLLAM
SFTKMENDRVLTDTLQLKGEAPQLKREVVQEVHEVIMPLDRREVQPDTTGCTRDGANTRE
GTITRDGSVMSGHIDGHRELMDWADVELNMCLQDGLDGSMTPYTERLYTDGSMTPMTEAS
WMDESLDGSSCPGTPDAAMDLPLLQPATMDRVSASGHLKSVIRRTKETPNVHPMYREGHP
RRGRMGPIIVNKSSSQDRLIEELQGKLGIGRLADRRHKQPDDWLTEGVIVMSKPQRFRGD
GAANEVDKIIIPSESPIPQRRVISPPQSPPAPCHPPIIEEPRRPSAVKQTPAPLPPPPPP
CPPPQLPLPHEPIPPPAPLVQPPPVPVQQPPAPKPEPPPPAAPSPMPPPPVQPAPPPPPP
KVLVSIGCQTEYDPIFPPMQIMAQGKGGPGGPPTQVNKLDNMLGSLQSDLHKLGVQTVAK
GVCGACCKPIVGQVVTAMGRTWHPEHFVCTHCQEEIGSRNFFERDGAPYCEMDYHNLFSP
RCHYCNGPILDKVVTALDKTWHPEHFFCAQCGSFFGPEGFHEKDGKAYCRKDYFDMFAPK
CGGCARAILENYISALNSLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHEQRGSLC
SGCQKPITGRCITAMGRKFHPEHFVCAFCLKQLNKGTFKDQNDKPYCQGCFVKLFS
NT seq 3591 nt   +upstreamnt  +downstreamnt
atggacgatttagacgctttgttggcggacctggaatccacgacgtcccacatctccaag
catcctgtgttcctgtctgaggagaccccctactcctttcccactggagggaactcctac
caggatgtgtcagtccctcccccggtgccaccccctccctcggctgaggctctgaatggc
tctgtgatagactccccggactcccaccactcctcccaacagtccttgggttcagctccg
aagagcttatggtccagggacagtagcagcccgcccgtgtcccacattgaagaggaccac
gtgtacagtttccccaacaaacagaagtctgctgaccagtctgcggctgctatgagctca
gctctgggcagtaacctgtcagagctggacaggctgctcctggagctcaacgctgtccag
cagaactctccatccttccccaccacagaggaaacagccccacccctgccatcctgcagc
ataacccactatgtgcaggagaacgggggtccccctgacgtcatggtgagccctcggtct
caggagaagaccaaacggaacgggagccaggcggtggaggagggccggcccactgtggag
agtctgctggatgagctggagggctctctacccactcccagcccctctgtcctccacaat
gagttggactcttcctctcagcagcaggccagaatgtcagcttcctgtgccacacgcgaa
cttgatgagcttatggcctccctttccgacttcaagcctgtcctcggctccttggggtct
atgaactctgaccttcagcttgatcaggcaggaacctcccccagcatcattctggaggtc
catcctcctccacgtacctgctcctcccttgctgcagctgccccctcctccctctcaccc
tctcaacctgcctgtgactctcctcttttctctctacctgcatgggagctgcacatagag
gaggaaagtggggactcagggggggcagtgtcccctccacatccctcattatcaagccct
cccccagctactgtaacctcccagagccctctgtcatttgcagagagtgacccagaacca
aaagttgtcatcgacgtctctgcgaccatcctgaagtctcgtcaaaagtcgctggtagcc
ctcaaccactccaacccttcacttagcacatacccaagtcctcctaatgctgctaaacca
tcactgaactcagccagtgtcaccctggacaataaccccttaaaatcccatagttcattt
ctagaaccttgtacaactccccctactgttaccaagagcaccagtcccctgactgacatg
gatctatgtttctctactccaaccactaccaagagtcttagtcctgttcctgtctctacc
tccaagactccttcacctctccatgcttctgtcaccaagactccttcacctctccatgct
tctgtcaccaagagtcctcctctcactgcttctaaagccccctcaccatctctggtcgct
tctcccaagtctccctctcccccagctctcaccagccccaagatctccaggagagttcta
gagccagtccctgcagctgagccctctctggatgaagccctggataagctgctggcaatg
agtttcaccaagatggagaacgatagagtccttactgacacactgcagctgaagggggag
gcacctcagctgaagagggaagtggtgcaggaggtacatgaggtcatcatgcccttagac
agaagggaggttcagccagacactactgggtgtacccgggatggggcaaatacccgtgag
gggacaattacccgggatgggtcagtaatgagtggacacatagacgggcacagggagctc
atggactgggctgatgtggagctgaacatgtgtctccaagatggactggatggtagtatg
actccttatacagagagactttatacagatgggagcatgaccccgatgactgaggccagc
tggatggatgagtccctggatggctcctcctgccctggaactcctgatgctgccatggac
ctacctctgctgcagcctgccaccatggacagggtctctgcatctggacatctgaagtcc
gtgataaggcgcaccaaggagacccccaatgtgcaccccatgtaccgagagggtcacccc
cggagggggcggatgggccccatcatcgtcaacaagagcagctcacaggaccgcctcata
gaggaactgcaggggaagctggggattggccgattggctgaccgccggcacaagcagccg
gacgattggctcactgagggcgtcatcgtcatgtccaagccacagcgtttccgtggcgat
ggggctgcgaatgaggtggacaagatcattattccctcggagtcacctatacctcagagg
agggtcatttccccaccccagtctcccccagccccttgtcaccctcctattatagaagaa
cccaggagaccctcagctgttaagcagacccctgctcccctacctcctccccctcccccc
tgcccccctcctcaacttcctctaccccatgaacccatccctcccccagctcctctggta
caacccccaccggtcccagtacagcagccccctgcccccaagccagagccccctccacct
gctgctccatccccaatgccccctccaccagtgcagcctgcaccaccaccacctcccccc
aaggtcctggtgtccattggctgtcaaacagaatacgacccaatttttcctccaatgcag
atcatggcccaggggaaaggtggccctggaggccccccaacacaggtcaacaagctggac
aacatgctcggcagtctgcagtcggacctccataaactgggtgtgcagactgtggccaag
ggagtgtgtggggcatgttgtaaacccatcgtgggacaggtggttactgccatggggcgc
acatggcacccagagcactttgtgtgtacccactgtcaggaggagataggttccagaaac
ttctttgagcgtgacggagcgccctactgtgagatggactaccacaacctgttctcccca
cgctgccactactgtaacggccctatactggataaagttgtgaccgcgttggacaagaca
tggcatcctgaacacttcttctgtgctcagtgtggatcattctttggcccagaaggtttc
catgagaaggatgggaaggcgtactgtaggaaggactactttgacatgtttgcaccgaaa
tgtggcggctgtgcccgagccattctggagaactacatctctgcgctaaactccctttgg
catccagagtgctttgtctgcagggagtgcttcaccccatttgtgaatgggagtttcttt
gagcatgatgggcagccttactgtgaggtgcactaccacgagcagcgaggctccctctgc
tcgggttgtcagaagcccatcaccggccgctgcatcacagccatgggcaggaagttccac
ccggagcactttgtttgtgccttctgcctcaagcagctcaacaagggcaccttcaaggat
cagaatgacaagccctactgccagggctgctttgtgaagctcttcagttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254785
Entry
112254785         CDS       T05605                                 

Gene name
pxn
Definition
(RefSeq) paxillin isoform X1
  KO
K05760  paxillin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112254785 (pxn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254785 (pxn)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254785 (pxn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112254785 (pxn)
Domain-containing proteins not elsewhere classified [BR:otw04990]
 LIM domain-containing proteins
  Paxillin family proteins
   112254785 (pxn)
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 112254785
NCBI-ProteinID: XP_024283400
LinkDB
Position
7
AA seq 530 aa
MDDLDALLADLESTTSHISKRPVFLPDETPYSFPTGGQAPPPVPPPPSAEALNGTLLDPL
DSTPLSTQSYSPAQKSLWSRDSSSPPLPQSEEDHVYSFPNKQKSTEAAMSSSLGCNLSEL
DRLLLELNAVQHNTPSFPTEEESAPPLPSSSTTHYVQANGVSGAGKLPRPTMDKPKRSVA
TRPPVIEDVRLSAKSLLDEQESSVPSPIPTPLVVEKLGEEETPSQLQARISASSATRELD
ELMASLSDFKVQSNILAQGKSSPTAPPKQSNKLDNMLGSLQSDLHKLGVQTVAKGVCGAC
NKPIVGQVVTAMGRTWHPEHFVCTHCQEEIGSRNFFERDGAPYCEKDYHNLFSPRCHYCN
GPILDKVVTALDRNWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCTR
AILENYISALNSLWHPECFVCRECFTPFVNGSFFEHEGQPYCEGHYHERRGSLCSGCQKP
ITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQGCFIKLFS
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggatgatttagatgcattgctggcggacttggagtcgacgacctcccacatctccaag
cggccagtgtttctgccggacgagacaccctactctttccccacgggaggacaggcccct
ccccctgtaccaccacctccctctgctgaggccctgaatgggaccttgcttgacccccta
gattcaacccccttgtccacacagtcctacagccctgcacagaaaagcttgtggtccagg
gacagcagtagcccccccttaccccaaagcgaagaggaccacgtctacagcttccccaac
aagcagaagagtacggaggctgccatgagctcctccctgggctgcaacctgtcggagctg
gaccggctgcttctggagctcaacgctgtacagcacaacacaccctccttccccactgag
gaggagtcagctccgcccctgccttccagcagcaccacccattatgtgcaagcgaacggg
gtttctggggcaggcaagttgcctcgccccaccatggataagccaaaacgcagcgtggcc
accaggccaccagtcatcgaagacgtgcgcctcagcgccaagagcctcctcgacgagcaa
gaaagttctgtgccctctcccatccccaccccattggtggtagagaagttgggggaggag
gagacgccctcccagctgcaggccagaatctcagcctcctccgccacgcgggagcttgac
gagctcatggcctcgctgtccgacttcaaagtccagagcaacatcctggcccaggggaag
agctcacccactgctccccccaaacagtctaataagctggacaacatgctgggcagcctc
cagtcagacctccataaactgggcgtccagactgtggccaagggagtgtgtggggcctgc
aacaagcccattgttggacaggtggtgactgccatggggcgcacatggcacccagagcac
tttgtgtgtacccactgtcaggaggagatcggctccaggaacttctttgagcgggacgga
gcaccttactgtgagaaggactaccacaacctgttctccccacgctgccactactgtaac
ggacctatcctggataaagtggtgacggctctggacaggaactggcatccggaacacttc
ttctgtgctcagtgtggagctttctttggcccagagggcttccatgagaaggatgggaag
gcatattgtcggaaggactactttgacatgtttgcgcccaagtgtggaggctgtacccgt
gccatcctggagaactacatatcagccctcaactccctctggcaccccgagtgttttgtc
tgcagggagtgcttcaccccctttgtaaatgggagcttctttgagcacgagggccagccc
tactgcgagggccactaccatgagcgccgcgggtccctctgctcgggctgccaaaagccc
atcacaggccgctgcatcacagcaatggccaagaagttccaccctgagcacttcgtctgt
gccttctgcctcaagcagctcaacaagggcaccttcaaagagcagaatgacaagccctac
tgccagggctgcttcatcaagctcttcagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263036
Entry
112263036         CDS       T05605                                 

Definition
(RefSeq) flocculation protein FLO11-like isoform X1
  KO
K05760  paxillin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112263036
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112263036
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112263036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112263036
Domain-containing proteins not elsewhere classified [BR:otw04990]
 LIM domain-containing proteins
  Paxillin family proteins
   112263036
SSDB
Motif
Pfam: Paxillin
Other DBs
NCBI-GeneID: 112263036
NCBI-ProteinID: XP_024294765
LinkDB
Position
12
AA seq 770 aa
MDDLDALLADLESTTSHISKRPVFLSEETPYSFPTGGNSYQDVSVPPPVPPPPSAEALNG
SVIDSLHSSQQSLGSAPKSSWSRDSSSPPRSHIEEDHVYSFPNKQKTADPSAGAMSSALG
SNLSELDRLLLELNAVQQNSPSFPTTEETAPPLPSCSITNYVQQNGGPPDLMVSPPVQEK
PKQNGTRVVEDGRPTVESLLDELEGSVPNPSPSVLHSELDSPSQQQARISASCATRELDE
LMASLSDFKLDQAEISPSSTLEVHPHPCTPSSPVAAAPSPLLSSQPACDSPLLSLPDWEL
HIEEEGGGAVSSPHPSLSSPPPATVTFQSPLFFAESEPEAFIDVSATMLSSHQKSLVVLN
HSKPSPSTDTSPPNAARPSLTSASTTLDQNPLKSPSPSLERGITPPSVTKSPSPLTDMDL
SLSTPTTTKSLSPVPFSYSKSPTPLTASKAPSPSLVTYPKAPPPPALTSPMISRRVLQPV
PAAEPSLDEALDKLLAMRLAKIENDKVPMEAPRLKREVVHEKCIMPLDRREVQPDTTGST
RNGARTGDEASTHEETFTRDGSVISGHVDGYRELMDWADVELNMCLQDGLDGGMTPNTER
PYTDGSMTPTTEASWMDESLDGSSCPGTPDASLDLPLLQQATVDRVSASGHLKSVIRRTK
ETSNVHPMYREGHPRRGRVGPIIVNKSSSQDRLIEELQGKLGIGRLADRRRKQPDDWLTE
GIIVMSKPQRLRGDGAANEVDKVGLDTITTGSHHPRYYCTFLINFYSNFT
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggacgatttagacgctttgttggcggacctggaatccacgacatcccacatttccaag
cgtcctgtgttcctgtctgaggaaaccccctactctttccccaccgggggaaactcctac
caggatgtgtcagtccctcccccggtgccgccccctccctccgctgaggctctgaatggc
tctgtgattgactccctccactcctcccaacagtccttgggttcagctccaaagagctca
tggtccagggacagtagcagcccgccccggtcccacattgaagaggaccacgtgtacagt
ttccccaacaaacagaagactgctgacccatctgctggagccatgagttccgcgctaggc
agtaacctgtcagagctagaccggctgctcctggagctcaatgctgtccagcagaactct
ccctctttccccaccacagaggaaaccgccccacccctgccatcctgcagcattaccaac
tatgtgcagcagaacggggggccccctgacctcatggtgagccctcccgttcaggagaag
cccaaacagaatgggaccagggtggtggaggatggccggcccacagtggagagtctgctg
gatgagctggagggttctgtacccaatcccagcccctctgttcttcacagtgagctggac
tctccctctcagcagcaggccagaatctcagcgtcctgtgctacacgcgagcttgacgag
ctcatggcctccctgtccgacttcaagctggatcaagcagaaatctcccccagcagcact
ctggaggtccatcctcatccatgtaccccctcctcccctgttgcagctgccccctccccc
ctcctttcctctcaacctgcctgtgactcccctctcttatcactgcctgactgggagctg
cacatagaggaggaaggtggcggggcagtgtcctctccacatccctcattatcaagccct
cccccagcaactgtaaccttccagagccctctgttctttgcagagagtgaaccagaagcc
ttcatcgacgtctctgccaccatgctgtcctctcatcagaagtccttggtagttctcaac
cactccaaaccttcacctagcacagacaccagtcctcccaatgctgctagaccatcactc
acctcagccagcaccacgctggaccagaaccccttaaaatcccctagtccatctctagaa
cgtggcataactcctccctctgttaccaaaagccccagtcccctaactgacatggatcta
agtttatcgactccaactactactaagagccttagtcctgttcctttctcttactccaag
tcccctactcctctcactgcttcgaaagccccctcaccatctctggtcacatatcccaag
gctccccctcccccagctctcacgagccccatgatctcaaggagagttctgcagccagtc
cctgcagctgagccctctctggatgaagccctggataagctgctggccatgcgtttggcc
aagattgagaacgataaagtccctatggaggcacctcggctgaagcgggaggtggtgcat
gagaaatgcatcatgcccttagacagaagggaggtgcagccggacaccaccggaagtacc
cggaacggggcaagaaccggggatgaggcaagtacccatgaagagacatttacccgggat
gggtcagtaataagtggacatgttgatgggtatagggagctcatggactgggccgatgtg
gagctgaacatgtgtctccaagatggactggatggtggtatgactcctaatacagagaga
ccttatacagatgggagcatgaccccgacgactgaggccagctggatggatgagtccctg
gatggctcctcctgccctgggactcctgatgcttccctggacctgcctttgctgcagcag
gccactgtggacagggtctcagcatctggacatcttaaatcagtgattaggcgcaccaag
gagacctccaacgtacaccccatgtaccgagagggtcacccccggagggggcgggtgggc
cccataattgtcaacaagagcagctcccaggaccgcctcatagaggagctgcaggggaag
ctggggattggtcgattggctgaccgccggcgtaagcagccggacgattggctcactgag
ggtatcatcgtcatgtccaagccacagcgcctccgtggcgacggggcagcgaacgaggtg
gacaaggttggcctggatacgatcacaacaggctcccaccatcccagatactattgcaca
tttctcataaatttttactcaaattttacttaa

DBGET integrated database retrieval system