KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249110
Entry
112249110         CDS       T05605                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112249110 (pdgfra)
   04020 Calcium signaling pathway
    112249110 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112249110 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249110 (pdgfra)
   04540 Gap junction
    112249110 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112249110 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112249110 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112249110 (pdgfra)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112249110 (pdgfra)
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112249110 (pdgfra)
CD molecules [BR:otw04090]
 Proteins
  112249110 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Receptor_2B4 C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 112249110
NCBI-ProteinID: XP_024274534
LinkDB
Position
1
AA seq 1466 aa
MDEMKRCLIIGVVLFGLLSVTCGLTPPTIVSTEDEFVLEPLSVFNISCTSKRNVAWVEPL
PVNTFVLPGFYMATLFIYNASVTHTGYYICKYQDEEGDEEDDEDNEAVIYVFVPDPKVPF
VPEEPGSMVVLVYPGETIIPCRVSDPRSPVVLKSVPSGVEVDAAYDNKIGFIGNLDAGLY
VCETIVNGVTMTSDIYTVKDNKLMEDFHVEVKASEEAVRLGEPFNITCVAPPGLPYQQQW
LHPMKQAVDAVQLKQALPDRVVYTLSIPAASSQDSGVYECSITNNFSGEIRANMVAVTVF
EENSFVMLDHSGIGAVEFVSMMEDTEFTISIEAFPAPKVTWLKDGIAITENSYFLTKTRR
LAGNHYQSTLTLRQSLEKDSGNYTVVVLSSAHTAQFSFTLKVKESGPVLFQPASAPVLFP
QREEWIVPLHTPFTLTCRGEAELAWDTPVYLSEQTEEDNSGLFITTVTVENATAGHTGFY
TCFYKGGNSTEEGEDSSIYIYVPDPEVPFVPSLVPFGNHVLNGHDEMEIQCRVSDPGANV
TLVNADTQQAVPMVVYDSKRGAVGFFSAGTYVCKALVNGEEHLSEEYIVHGWAGGSELRV
ELKAQKTALLVGDTITVICVARGSEILEDHWKYPGKLVDRGLKSVRENKRDQEIQYTLTV
PQASAKDSGIYVCSITDIISNENQTKKLAITVYERPFVSLRPAFSSQESADLDEVRQFQA
DIDSFPSAQVTWLKDGLPLNDVAAEITTSLRQVSETRYQSVLTLIRAKEEDSGNYTIRVQ
NGNQTHSHNFSLQVKVPAVIVDLMDLHHGSASGQSVVCIAGGMPTPKVEWFICKNIKHCA
NDSSEWVPLPTNNTEITVEAHIDQDNQLESQVIFGHLENTLAVRCLARNEMATVSREVKL
VSQDPHSELTVAAAALVLLVFVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYVD
PMQLPYDSRWEFSRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSS
EKQALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYLHKNRENFVSV
HPEKTKKDLDIFGINPADESSRSYVILSFESGKGDYMDMKQADTTQYVPMLEMSDASKYS
DIQRSEYNHPPSQKGDSEMDNMLSGDGNEGLSTTDLLSFTYQVARGMEFLSSKNCVHRDL
AARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNMYTTLSDVW
SYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPTDVYEMMMKCWNSEPEK
RPSFFSLSESVASLLPSGYKRCFERVNHEFLKSDHPAVTRVQVENDDTYVGITYKNQGKS
KDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYCKRNRHSSQTSEESAIESGSSSTLAKR
EGETLEDITLLDEMCLDSELVEDSFL
NT seq 4401 nt   +upstreamnt  +downstreamnt
atggatgaaatgaagagatgtctcatcattggggtggtcttgtttggattgttatcggtt
acctgcggactgacgccaccgaccattgtatcaactgaagatgagtttgttctcgagcca
ctctctgttttcaacatcagctgcactagtaaaaggaacgttgcttgggtcgagccctta
ccggtcaacacattcgttttgcctggattttacatggccacgctcttcatctataacgct
tccgtgacacacaccggatattacatctgcaaataccaagacgaagagggcgatgaagag
gatgatgaagacaatgaagcagtcatatacgtttttgtcccagatcccaaggttccgttc
gtgcccgaggagccaggtagcatggtagttctagtctatcctggtgaaaccatcatccca
tgcagggtgtcagaccctcgatccccggtggtcctaaagagtgttcccagtggagtagag
gtggacgctgcttatgacaacaagatcggcttcattggcaacctggacgctggactctac
gtctgtgagaccatcgtgaacggcgtgacaatgaccagtgacatctacaccgtgaaggac
aacaaactgatggaggacttccatgtggaggtgaaggccagcgaggaggcagtgagactg
ggggaacccttcaacatcacctgtgtggcacctccaggactgccctaccagcagcagtgg
cttcaccccatgaaacaggctgtggatgcagtccagttgaagcaggctctgcctgataga
gtggtctacaccctcagtatcccagcagcctcctctcaggacagtggggtgtatgagtgc
tctatcaccaacaacttcagtggagagatcagagccaacatggtggctgtcactgtcttc
gaggagaactcctttgtgatgttggaccacagtgggattggagcggtggagtttgtcagt
atgatggaggacacagaattcaccatcagtattgaagccttccctgctcctaaagtcacc
tggctgaaagacggtatcgccatcactgagaacagctacttcctcaccaagaccagacgt
ctggcgggcaaccactatcagagcactctgactcttcggcagtcactagagaaggacagt
gggaattacaccgtcgtggtcctcagcagcgctcacactgcccagttctccttcaccctc
aaagtgaaagaatcaggcccagtactgttccagccagcctcagcgccagtgctgttcccc
cagagagaggagtggattgttcccctccacacccccttcaccctgacctgcaggggcgag
gccgagctggcctgggacacgcccgtctacctatcggagcagaccgaggaggacaacagc
ggcctgttcatcaccactgttaccgtagagaacgcgacagcagggcacactggcttctac
acctgcttctacaaaggagggaactccactgaggaaggagaggacagcagcatctacata
tatgtgccagatccagaggtgcccttcgtaccctcgctggtgccctttggaaaccacgtc
ctgaatggtcatgatgagatggagatccagtgtcgcgtatcagaccccggtgccaatgtg
accctggtcaacgctgatacccagcaggccgtgcccatggtggtttacgacagcaagagg
ggtgccgtgggcttcttcagcgcaggaacctacgtctgtaaggccctcgtcaacggagag
gagcacctcagtgaggagtacatcgtccacggctgggcaggggggtcggagctgcgtgtg
gagctgaaggcccagaagacagccctcttggtgggagacaccattactgtcatttgtgtg
gcccgggggtctgagatactggaagaccactggaagtaccctggaaaactggtggaccgg
ggcttgaagtcggtgcgtgagaataagagggaccaggagatccagtacacattgactgtc
ccccaggcctcagccaaagacagtggcatctatgtctgctccatcactgacatcatcagc
aacgagaaccagaccaagaagctggccatcactgtctatgagaggccattcgtgtcgctg
cgcccggcgttcagttcacaggagtcagcagatttggatgaggtcagacagttccaggct
gacattgactcctttcccagcgctcaggtcacatggctcaaagatggcctccctctcaac
gacgtggcggctgagataaccaccagcctccggcaggtcagcgagaccaggtaccagagt
gttctgaccctgattcgggccaaagaggaggacagtggaaactacaccatcagagtgcag
aacgggaaccagacccacagccacaacttcagcctgcaggtcaaagtgcctgcagtcatt
gtggacctgatggacctccaccatggctcagcctcaggccagtctgtagtgtgtatcgct
ggaggcatgcccactcctaaggtggagtggttcatctgcaagaacatcaaacactgtgcc
aacgactcgtctgagtgggtgcccctgcctaccaacaacacagagatcactgtggaagcg
cacatcgaccaggacaaccagctggagagtcaggtgatctttgggcatctggagaacacc
ttggctgttcgctgcctggccaggaacgagatggccaccgtcagcagggaggtcaaactg
gtgtcacaagaccctcactcagagctgactgtagctgctgctgccctggtgctgctggtc
tttgtcatcatctcactcattgttctggtcattatctggaaacagaagcctcgctatgag
atccgttggagggtgatagagtcagtgagccctgatggtcatgagtacatctacgtggac
cccatgcagctgccctatgactccagatgggagttctctcgtgatgggctcgtactggga
cgtatcctgggctctggggcgtttgggaaggtggtggagggaactgcatacggactcagc
cgctcccagcccgtcatgaaggtggccgtgaagatgctgaaacccacggcccgctccagt
gagaaacaggccctgatgtcagagctgaagattatgactcacctgggccctcacctcaac
atcgtcaacctgcttggggcctgtaccaagtcaggccccacctacatcatcactgagtac
tgcttctatggagaccttgtcaactacctgcacaagaacagagaaaactttgtcagcgtg
cacccagagaagaccaagaaagacctggacatctttggcatcaaccctgcagacgagagc
agcaggagctatgtgatcctgtcctttgagagtggtaaaggggactacatggacatgaag
caggcagacaccacgcagtacgtgcccatgctggagatgagtgacgcctccaagtactcc
gacatccagaggtccgaatacaaccacccgccatcacagaagggtgatagtgagatggac
aacatgctgtcaggggatggtaacgagggcctcagcaccacagacctgctcagcttcacc
taccaggtggccagaggcatggagttcctatcctctaagaactgtgtgcatcgggacctg
gctgccaggaatgtcctgctctctcaggggaagatagtaaagatctgtgactttggcctg
gccagagacatcatgcacgacaacaactacgtctccaaaggcagcaccttcctgccagtg
aagtggatggccccggagagtatctttgacaacatgtacaccaccctcagtgacgtctgg
tcctacggcatcctcctctgggagatcttctctctaggtggcaccccatacccagggatg
gtagtggactccagcttctacaacaagatcaagagtggctacaggatggccaaacctgag
catgcccccactgatgtgtatgagatgatgatgaagtgttggaatagtgagcctgagaag
aggccttccttcttcagcctgagtgagagcgtggcctcactgctgccttccggctacaag
aggtgtttcgagagggtgaaccatgagttcctgaagagtgaccacccggcagtgaccagg
gtccaggtggagaatgacgacacctacgttgggatcacctataagaaccagggcaagtcg
aaagacagggagagtggcttcgacgagcagcgcctcagctctgacagtggttacatcatc
ccccttcctgacctggaccccctgtctgatgacgagtactgcaagaggaatcgccacagc
tctcagacgtctgaggagagtgccatagagtcgggctccagctccacgctggccaagaga
gaaggagagaccctggaggacatcaccctattggatgagatgtgtctggactcagagctg
gtggaggacagctttctgtga

DBGET integrated database retrieval system