KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250658Help
Entry
112250658         CDS       T05605                                 

Definition
(RefSeq) elongation of very long chain fatty acids protein 1-like
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00062  Fatty acid elongation
otw01040  Biosynthesis of unsaturated fatty acids
otw01100  Metabolic pathways
otw01212  Fatty acid metabolism
Module
otw_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    112250658
   01040 Biosynthesis of unsaturated fatty acids
    112250658
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:otw01004]
    112250658
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     112250658
Lipid biosynthesis proteins [BR:otw01004]
 Elongase
  PUFA
   112250658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 112250658
NCBI-ProteinID: XP_024276768
LinkDB All DBs
Position
5
AA seq 319 aa AA seqDB search
MLQDIGARAMEVYEFLLKGTDPRLWGYPLMQSPVNMTAILLTYIFFVLVAGPRFMANRKP
FQLKEAMIAYNFTMVAMSTFIVYEFLMSGWATTYTWRCDAIDYSDSPQGLRMVRVAWLFL
FSKFIELLDTVFFVLRKKHGQITFLHVFHHSFMPWTWWWGVSFAPGGMGSFHAMVNSIVH
IIMYSYYGLSAAGPQFQKFLWWKKYMTAIQLVQFVMVSLHATQYYFMNSCDYQVPLFIHL
IWMYGTFFFVLFSNFWYQAYVKGKRLPKQDTKPSLNGKANGTTLVANGKYHENSTSNGTS
NSSSHHKNGSAHADKMKKS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggacattggtgctagagccatggaggtctacgagttcctcttgaagggaaca
gacccgcgattgtggggctacccactcatgcagagtccggtgaacatgacggccatcttg
ctgacctacatcttcttcgtgctggtcgctgggcctcgcttcatggccaaccgcaagccc
ttccagctcaaggaggccatgatcgcctacaactttaccatggtggcgatgtcaaccttt
attgtctatgagttcttgatgtctggctgggccacaacatacacatggagatgtgacgca
attgattactcagacagcccccaaggccttagaatggttcgagtggcctggttgttcttg
ttctccaaattcattgagctcttggacacggtgttcttcgttctgaggaagaaacatggc
cagatcaccttcctgcatgtcttccaccactccttcatgccctggacctggtggtggggc
gtcagcttcgctcccggaggaatgggctctttccatgccatggtgaattccatcgtccac
atcatcatgtattcttactacggcctgtctgcggctggaccacaattccaaaagttcctc
tggtggaagaagtacatgaccgccatccagctggttcagtttgtgatggtgtcccttcac
gccacccagtattacttcatgaatagctgtgactaccaggttcccctgttcatccacctc
atctggatgtatggcaccttcttctttgtgctcttctccaacttctggtaccaggcttac
gtaaagggcaagaggttgcccaagcaggataccaagcccagcctcaatggcaaggccaac
gggaccaccttggtcgccaatggcaaataccatgagaacagtaccagcaatggcaccagc
aacagttccagtcaccacaaaaatggcagtgcccatgcggacaagatgaagaagtcctag

DBGET integrated database retrieval system