KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250771
Entry
112250771         CDS       T05605                                 

Definition
(RefSeq) sphingosine 1-phosphate receptor 4-like
  KO
K04293  sphingosine 1-phosphate receptor 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112250771
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112250771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112250771
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    112250771
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 112250771
NCBI-ProteinID: XP_024276953
LinkDB
Position
5
AA seq 399 aa
MDALSSLSSSTSCSHLYLWASNTTNSSAVNIDVILEHYNHTGRLQHRVPRQGGLSSAAVL
SLFISVLIILENLLVLVAVLSRILHSRRWVYVCIANITLSDLLAGAAYVVNIWMSGSQTF
RLSPALWLFREGVLFVALAASIFSLLLIAVERYTTMMKPLHQKSARKTYRIYGLVALCWI
VAFAIGFLPLLGWNCVCSLESCSTLLPLYSKSYILFSLLIFSLILLAIGVLYGAIYSHVR
SSSKVGSQRSRKRSLGLLKTVISIVGVFIICWGPLFILLLVDFFCVSRQCAPLFSADWVI
ALAVINSALNPVIYTLGSTELRKAIAGLLCCCCLRAGLCHPDTFVSKETSSTGSIRHSSL
RNSFNKIRSLTVSPPPAPNAPKKSRRLSSTTTCLSVSSG
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggatgccctgtcctccctgagctcctcaacctcctgctctcatctgtacctctgggcc
agcaacaccaccaacagcagcgctgttaacattgatgtgatcctggagcactacaaccac
acagggcgcctgcagcatcgcgtgccccgccagggtggcctgagctcggcagcggtcctc
tccctcttcatcagcgtcctcatcatcctggagaacctgctggtcctagtggctgtgctc
tcccggatcctccacagccgccgctgggtctacgtgtgcatcgccaacatcaccctgagc
gacctgctggccggggcggcctacgtggtcaacatctggatgtcgggcagccagacgttc
agactgagcccggctctgtggctgttcagggagggggtactgttcgtggccctcgccgcc
tccatcttcagcctgctgctgatagctgtggagcgctacaccaccatgatgaagccgctg
caccagaagtcggccaggaagacgtatcgtatctacggcctggtggcgctgtgctggatc
gtggccttcgccatcggcttcctccccctgctgggctggaactgtgtgtgcagcctggag
agctgctctaccctgctgccgctctactccaagagctacatcctcttctcccttctcatc
ttctccctcatcctgctggctatcggcgtgctctatggcgccatctacagccacgtgcgc
agcagctccaaggtgggctcccagcgcagccgcaagcgctccctggggctgctgaagaca
gtcatctccatcgtgggtgtgttcatcatatgctggggccctctgttcatcctgctgctg
gtggacttcttctgtgtgtcgcggcagtgcgcaccgctcttcagcgccgactgggtcatc
gccctggccgtgataaactcggccctgaacccggtcatctacaccctgggcagcacagag
ctgaggaaggccattgccggcttgttgtgctgctgctgcctcagggcaggcctctgtcac
cctgacacctttgtgtccaaggagaccagcagcaccgggagcatcaggcacagcagcctg
aggaacagtttcaataagatcaggagtctcactgtcagccccccgcctgcacccaatgcc
cccaagaagagccgccgcctgagctccaccaccacctgcctgtctgtgtcaagcggttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251541
Entry
112251541         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: sphingosine 1-phosphate receptor 1-like
  KO
K04288  sphingosine 1-phosphate receptor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112251541
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112251541
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112251541
   04090 CD molecules [BR:otw04090]
    112251541
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    112251541
CD molecules [BR:otw04090]
 Proteins
  112251541
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 112251541
NCBI-ProteinID: XP_024278291
LinkDB
Position
5
AA seq 360 aa
RHYNFTGKLRKVEQDSRLKADSVVFIIVCCFIILENLGLLXIWRTKKFHKPMYYFXGNLA
LSDLLAGVVYTANILLSGANTYKLTPTQWFFREGSMFVALAASVFSLLAIAIERHLTMLK
MKLHNNGNTCRVFMLISTVWLIAAILGGLPIMGWNCIQSMPSCSTVLPLYHKTYILFCTT
VFSVILMAIVVLYARIYALVRTRSRKLVFRKVSNGRGGGSASSKSSEKSMALLKTVIIVL
SCFIACWAPLFILLLLDVACDIRMCAILYKAEWFLALAVLNSAMNPLIYTLTSNEMRRAF
LKTLMCCSVCTRPSGKFSRPIMGAEFSRSKSDNSSHPNKDEPEYSPRETVVSSGNITSSS
NT seq 1083 nt   +upstreamnt  +downstreamnt
cgacactacaacttcacagggaagctccggaaagtggagcaggattccagactcaaagcg
gactctgtggttttcatcattgtatgttgcttcattatccttgagaatcttggtctgctc
nncatttggaggaccaagaagttccacaagcccatgtactactttnatgggaacttagcc
ctatcagacttgctggctggtgtggtgtacactgccaacatcctgctgtcaggtgccaac
acatacaaactgacccccacacagtggttcttccgggaggggagtatgtttgtggccctg
gcagcctcagtcttcagcctgctggccatcgccatcgagcgccacctcaccatgctgaag
atgaagttgcacaacaatggcaacacgtgccgtgtcttcatgctcatcagcaccgtgtgg
ctgattgcagccatcttgggcggcctgcccatcatgggctggaactgcatccagagcatg
cccagctgctccaccgtactgccgctctaccacaagacctacatcctgttctgcaccacc
gtcttcagtgtcatcctcatggccatcgtggtcctgtacgcgcgcatctacgccctggtg
cgcacccgcagccgcaagctggtgttccgcaaggtctctaacggccgcggcgggggtagc
gctagcagtaagagctcggagaagtccatggccctgctgaagaccgtgatcatcgtgctg
agctgtttcattgcctgctgggctccactcttcatcctcctgttgctggacgtggcctgc
gacatccgcatgtgtgccatcctgtacaaagccgagtggttcctggccctggccgtgctc
aactcggcaatgaaccccctcatctacacgctcaccagcaacgagatgcgccgcgccttc
ctaaaaacgctcatgtgctgcagtgtctgcacccggccctctggcaagttctctcggccc
atcatgggtgcagagttcagccgaagcaagtcggacaactcgtcccaccccaataaggac
gagccagagtactcgccgagggagaccgtcgtatcctctgggaatatcacctcctcttct
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252084
Entry
112252084         CDS       T05605                                 

Gene name
s1pr1
Definition
(RefSeq) sphingosine 1-phosphate receptor 1
  KO
K04288  sphingosine 1-phosphate receptor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112252084 (s1pr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112252084 (s1pr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112252084 (s1pr1)
   04090 CD molecules [BR:otw04090]
    112252084 (s1pr1)
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    112252084 (s1pr1)
CD molecules [BR:otw04090]
 Proteins
  112252084 (s1pr1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF3278
Other DBs
NCBI-GeneID: 112252084
NCBI-ProteinID: XP_024278783
LinkDB
Position
6
AA seq 372 aa
MGDSMYSDLIARHYNFTGKLRKVEQDSSLKADSVVFIIVCCFIILENVLVLLTIWRTKKF
HKPMYYFIGNLALSDLLAGVVYTANILLSGANTYKLTPTQWFFREGSMFVALAASVFSLL
AIAIERHLTMLKMKLHNNGNTCRVFMLISTVWLIAAILGGLPIMGWNCIQSMPSCSTVLP
LYHKTYILFCTTVFSVILMAIVVLYARIYALVRTRSRKMVFRKVSNGRGGGSASSKSSEK
SMALLKTVIIVLSCFIACWAPLFILLLLDVACDIRMCPILYKAEWFLALAVLNSAMNPLI
YTLTSNEMRRAFLKTLLCCSVCTQPSGKFSQPIIGAEFSRSKSDNSSHPNKDEPEYLPRE
TIVSSGNITSSS
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgggtgactccatgtattctgacttgatagccagacactacaacttcacagggaagctc
cggaaagtggagcaggattccagyctcaaagcggactctgtggttttcatcattgtatgt
tgcttcattattcttgagaatgtcttggtcctycttaccatttggaggaccaagaagttc
cacaagcccatgtactactttattgggaacttagctttatcagacttgctggctggggtg
gtgtacactgccaacatcctgctgtcaggtgccaacacatacaaactgacccccacacag
tggttcttccgggaggggagtatgtttgtggccctggcagcctcagtcttcagcctgttg
gccatcgccattgagcgccacctcaccatgctgaagatgaagttacacaacaatggcaac
acgtgccgtgtcttcatgctcatcagcaccgtgtggctgattgcagccatcttgggcggc
ctgcccatcatgggctggaattgcatccagagcatgcccagctgctccaccgtactgccg
ctctaccacaagacctacatcctgttctgcaccaccgtctttagcgtcatcctcatggcc
atcgtggtactgtacgcgcgcatctacgccctggtgcgcacccgcagccgcaagatggtg
ttccgcaaggtctccaacggccgcggcgggggtagcgctagcagcaagagctctgagaag
tccatggccctgctgaagaccgtaatcatcgtgctgagctgtttcatcgcctgctgggcc
ccactcttcatccttctgttgctggacgtggcctgcgacatccgcatgtgccccatcctg
tacaaggccgagtggttcctggccttggccgtgctcaactcggccatgaatcccctcatc
tacacactcaccagcaacgagatgcgtcgcgccttcctcaaaacgctcctgtgctgcagc
gtctgcacccagccctccggcaagttctcccagcccattattggtgcagagttcagccgg
agcaagtcggacaactcgtcccaccccaataaggatgagccggagtacttgccaagggag
accatcgtatcctctgggaatatcacctcctcttcttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252176
Entry
112252176         CDS       T05605                                 

Definition
(RefSeq) sphingosine 1-phosphate receptor 4-like
  KO
K04293  sphingosine 1-phosphate receptor 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112252176
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112252176
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112252176
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    112252176
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 112252176
NCBI-ProteinID: XP_024278954
LinkDB
Position
6
AA seq 401 aa
MDSMSSLSSSTSCPYLYLWSSNITNNSSRSSISNNVILEHYNHTGRLQHRGPRQGGLSLG
ASLSLFISILIILENLLVLVAVLSRIRNSHRWVYVCIANITLSDLLAGAAYVVNICMSGS
HTFRLSPALWLFREGVMFVTLAASIFSLLLIAVERYTAMMKPLHQKSARKTCRIYGLVAL
CWILAFAIGFLPLLGWNCVCSLESCSTLLPLYSKSYIFFSLLIFSLILLAIGVLYGAIYC
HVRSSAKVGSQRSRKRSLGLLKTVISIVGVFIMCWGPLFALLLLDFFCVSRQCAPLFSAD
WVIALAVLNSALNPVIYALGSTELRKAIAGLLCCCCLRAGLCHPDAFVSKETSSTGSTRH
SSLRNSFNKVRSFSISPPPAPKAPKKSRLSSTTSCLSVSSS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggattccatgtcctccctgagctcctcaacctcctgcccctacctgtacctctggagt
agcaacatcaccaacaacagcagtagaagcagtattagcaacaatgtgatcctggagcac
tacaaccacacagggcgcctgcagcaccgcgggccccgccaaggtggcctgagcttgggc
gcgtccctctccctcttcatcagcatcctcatcatcctggagaacctgctggtcctggtg
gccgtgctctccaggatccgcaacagccaccgctgggtctacgtgtgcatcgccaacatc
accctcagtgacttgctggctggggcggcctacgtggtcaacatctgcatgtctggcagc
catacgttcagactgagcccagctctgtggctgttcagggaaggggtgatgtttgtgacc
ttggctgcctcgatcttcagcctgctgctgatagcagtggagcgctacaccgctatgatg
aagccgctgcaccagaagtcagccaggaagacatgtcgtatctacggcctggtggcgctg
tgctggatcctggccttcgccatcggcttcctccccctgctgggatggaactgcgtgtgc
agcctggagagctgctccaccctgctgccgctctactccaagagctacatcttcttctct
ctgctcatcttctccctcatcctgctggccatcggtgtgctctacggcgccatctactgc
cacgtgcgcagcagcgccaaggtgggatcccagcgcagccgcaagcgatccctggggctc
ctgaagacagtaatctccatcgtgggtgtgttcatcatgtgctggggccctctgttcgcc
ctgctgctgctggactttttctgtgtgtcgcggcagtgtgcacccctcttcagtgccgac
tgggtcattgctctggctgtgctcaactctgctctgaaccctgtcatctacgccctgggt
agcacagagctgaggaaggccatcgcggggctgctgtgctgctgctgcctcagggcaggc
ctctgtcaccctgatgccttcgtgtccaaggagaccagcagcacggggagcaccaggcat
agtagcctgaggaacagtttcaataaggtcaggagtttcagtatcagccccccgcctgca
cccaaggcccccaagaagagccgcctcagctccaccaccagctgcctgtctgtgtcgagc
agttag

DBGET integrated database retrieval system