KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250956Help
Entry
112250956         CDS       T05605                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00590  Arachidonic acid metabolism
otw01100  Metabolic pathways
otw04370  VEGF signaling pathway
otw04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112250956
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112250956
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112250956
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     112250956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 112250956
NCBI-ProteinID: XP_024277301
LinkDB All DBs
Position
1
AA seq 609 aa AA seqDB search
MNRSISALLFLSLGIIFVCEGGNPCCSQPCQNRGVCTAMGPDDYECDCTRTGFYGHNCTQ
PKLFTWIKVSLKPTPNTVHYLLTHYKGLWNIINSISFLRDAIMRYVLTSRSHLIDSPPTF
NTDYDYKSWEAYSNLSYYTRTLPPLPKDCPTPMGVVGKKELPNAEMLAKKLLIRTKFIPD
PQGSSLMFAFFAQHFTHQFFKSDQKMGPAFTKAKGHGVDLGHIYGDNLERQHNLRLFKDG
KLKFQVLEGEVYPPTVKEVGVDMHYPPHVPESHRFAVGHEAFGLVPGLMMYATIWLREHN
RVCDVLKEVHPDWDDDRLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFKER
FQYQNRIASEFNTLYHWHPLMPDAFHIQEQVYSYPQFVFNTSVVTTHGITNLVESFTKQI
AGRVAGGRNVPPAVLMVALKSIENSRQMRYQSLNAYRKRFSMKPYISFEDLTGDKEMAAE
LEEMYGHVDAVELYPGLLVEKPRTNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTF
GGSIGFNIINTASLQRLVCSNIKGPCPLASFHVPDIKDNGSNVNNSSTAHSGSNDRNPTV
LLRERTTEL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaagcatatcggcgcttttatttctgtctctaggcataatatttgtctgcgaa
ggaggcaacccttgctgctcacagccatgccagaaccgtggcgtttgtacggccatgggc
cccgacgactatgagtgcgattgcacacgcacgggattttatggccacaactgcacacaa
cctaaattattcacgtggattaaagtgtctctgaagccaacacccaacactgtgcattac
ctcctcacccactacaaggggctctggaacatcatcaacagcatatcattcctcagggat
gctatcatgagatatgttctgacatctcgctctcatctgattgacagccccccgactttc
aatacagactatgattataaaagctgggaagcctactcaaatctctcctactacacacgc
acgctccctcctctgcccaaggattgcccaactcctatgggagtcgtaggtaagaaggag
ctgcctaatgcggagatgctggcaaagaagctcctgatcaggacgaagtttatcccagac
cctcagggctccagtctgatgtttgccttctttgcccaacacttcacccaccagttcttc
aaatccgaccagaagatggggccggccttcactaaagccaagggacacggcgtggacctg
ggtcacatttacggtgataaccttgagaggcaacacaatctgcggctcttcaaggatggc
aagctgaagtttcaggtcttggagggagaggtgtacccacctacagtgaaggaggtaggg
gtggatatgcactaccctccccatgtccctgagtctcaccgcttcgctgtgggccatgag
gcattcggcctggtgcctggtcttatgatgtatgctaccatctggctgagagaacacaac
cgagtctgtgatgtcctgaaggaggtacatccggactgggatgatgataggctcttccag
acatctcgcctcattctcattggtgagaccatcaaaattgtgattgaggactacgtgcag
cacctgagcggctaccacttcaagctaaagttcgacccagagcttctcttcaaagagcgt
ttccagtatcagaaccgcatcgcatcagagttcaacaccctgtaccactggcacccactg
atgcccgacgccttccatatccaggagcaggtctactcctacccacagtttgtcttcaac
acctctgtggtcaccacacatggaatcaccaacctggtggagtccttcaccaagcagatt
gctggacgggttgctggaggtcgtaatgtcccccctgcagtgctaatggtggctctgaag
tccatagagaacagcagacagatgcgctaccagtcccttaatgcctacaggaaacgcttc
tccatgaagccatacatctccttcgaagacctcacaggggataaggagatggctgcagag
ctggaggagatgtatgggcatgtggatgctgtggagctctacccaggcctgctggtggag
aagccaagaaccaatgccatctttggggagaccatggtggagatgggtgccccctactcc
ctgaaaggcctgatgggaaaccccatttgttcgccagagtactggaagcccagcaccttc
ggtgggagcatcggctttaacatcatcaacacagcgtccctacagaggctggtgtgcagc
aacatcaagggcccctgccctttggcatcctttcatgtgcccgacataaaagacaatgga
tccaatgtcaataattccagtacggcacattcgggaagtaacgatcgcaaccccacagta
cttctaagagaaaggaccactgagctctga

DBGET integrated database retrieval system