KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251205
Entry
112251205         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha-like isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251205
   04020 Calcium signaling pathway
    112251205
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112251205
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112251205
   04540 Gap junction
    112251205
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112251205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112251205
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112251205
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112251205
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112251205
CD molecules [BR:otw04090]
 Proteins
  112251205
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Receptor_2B4 Kinase-like
Other DBs
NCBI-GeneID: 112251205
NCBI-ProteinID: XP_024277810
LinkDB
Position
5
AA seq 1476 aa
MDEMKTCLIIGVFLFGLLSVTRGLATPTIVSTEDEFVLEPLSVFNISCTGKRNVAWVEPL
PDDTFVLPGYYTSTLFIYNASVTHTGYYSCKYQDKEGDEEVDGVANDAFIYVFVPDPEIP
FVPQEPDRMLVPVYPNRTIIPCRVSDPQSQVVLKSAPSGVEVDAAYKNKIGFIGNLDAGL
YICETTVNSMTITSDTYTVEANKQIENVHVEVKASEEAVRLGEPFNITCVAPPGLPNQQQ
WLHPRKQAVDAVQMKQTLPDRMVYTLSIPAATSQDSGVYECSITNNISGEIRANRVAVTV
FEENPFVMLDHSGIGVVEFVSMMEETEFTISIEAFPAPKVTWLKDGIAITENSYFLTKTS
LLEGNKHQSTLTLRQPLEEDSGNYTIMVLSIPHTAQFSFTLKVKASAPVLFQPASAPVLF
QPASAPVLIPQREEMVVPLHTPFTLTCRGEAELAWDTPVYLSEQTEEDNSGLFVTTVTVE
NATAANTGFYTCFYNGGNSTEEGEDSSIYIYVPDPEVPFVPSLVPFGNHVLNGHDEMEIQ
CRVSDPSANVTLVNTDTQQAVPMTVYDSKRGAVGFFSAGTYVCKALVNGEEHLSEEYIVH
GWAGGSELRVELKALKTALLVGDTITVTCVARGSEILEDHWKYPGKLVNRGLKSVRENKR
DQEIQYIMTVPQASAKDSGIYACSITDIISNESQTKELAITVYESPFVSLRPVFSSQESA
DLDESREFRADIDSFPSAQVTWLKDGLPLNYVAAEITNSLQQLSETRYLSVLTLIRAKEE
DSGNYTIRVQNGNQTHSHSFSLQVKVPAVIVDLMDLHHGSASGQSVVCIAGGMPTPEVEW
FICKNIKHCANDSSQWVPLPTNDTDITVEAHFDQDNQLESQVIXVRLENTLAVRCLARNE
MAAVSREVKLVSQGPHSELPVTAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVS
PDGHEYIYVDPMQLPYDSRWEFSRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAV
KMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYL
HKNRENFLSLHSEKSKKDLDIFGINPADESSRSYVILSFESGKGDYMEMKQADTTQYVPM
LEMSDASKYSDIQRSEYDHPPSQKGDNEMDNLLSEDGNEGLSTTDLLSFTYQVARGMEFL
SSKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFD
NMYTTLSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPADVYEMM
IKCWNSEPEKRPSFLSLSESVASLLPSGYKRCFERASHEFLKSDHPAVTRVQVESDDTYI
GITYKSQDKLKDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYVKRNRHSSQTSEESAIE
TGSSFTLAKREGETLEDISLLDEMCLDSELVEDSFL
NT seq 4431 nt   +upstreamnt  +downstreamnt
atggatgaaatgaagacatgtctcatcattggggttttcttgtttgggttgttatcagtt
acccgcgggctggccacaccgaccattgtatcaactgaagatgagtttgttctcgagccg
ctctcggtgttcaacatcagctgcactggtaaaaggaacgttgcttgggtcgagccccta
ccggacgacacattcgttttgcctggatattacacctccacgctcttcatatacaacgct
tctgtgacacacaccggatattactcctgcaaataccaagacaaagagggcgatgaagag
gtggatggcgtagccaatgatgcgttcatatacgttttcgtcccagatcctgagattcca
tttgtgccccaggagccagatcgcatgctagtcccagtctatcccaatagaaccatcatc
ccatgcagggtgtcagaccctcaatcccaggtggtcctaaagagcgctcccagtggagta
gaggtggacgcagcttataagaacaagatcggcttcattggcaacctggacgctggattg
tacatctgtgagaccaccgtgaacagcatgacaattacgagtgacacttacaccgtggag
gccaacaaacagatagagaacgtccatgtggaggtgaaggccagcgaagaggcagtgaga
ctaggggaacccttcaacatcacctgtgtggcacctcctggactgcccaaccagcagcag
tggctccaccccaggaaacaggctgtggatgcagtccagatgaaacagactctgcctgat
agaatggtctacaccctcagtatcccagcagccacctctcaggacagtggggtgtatgag
tgctccatcaccaacaacatcagtggagagatcagagccaacagggtggctgtcactgtc
tttgaagagaacccctttgtgatgttggaccacagtgggattggagtggtggagtttgtc
agtatgatggaggagacagagttcaccatcagtattgaagccttccctgctcctaaagtc
acctggctgaaagatggcatcgccatcactgagaacagctacttcctcaccaagaccagc
cttctggaggggaacaagcatcagagcactctgactcttcggcagccactagaggaggac
agtggtaactacaccatcatggtcctcagcatccctcacactgcccagttctccttcacc
ctcaaagtgaaagcctcagccccagtgctgttccagccagcctcagccccagtgctgttc
cagccagcctcagctccggtgctgatcccccagagagaggagatggttgttcccctccac
acccccttcactctgacttgcaggggcgaggccgagctggcctgggacacgcccgtctac
ctatcagagcagacagaggaggacaacagcggcctgttcgtcaccacggttaccgtagag
aacgccactgcggcaaacactggtttctatacctgcttctacaacggagggaactccact
gaggagggagaggacagcagcatctacatatatgtgccagatccagaggtgccctttgtc
ccctctctggtgccctttggcaaccacgtcctgaatggtcatgatgagatggagatccag
tgtcgcgtgtcagaccccagtgccaatgtgaccctggtcaacactgatacccagcaggcc
gtgcccatgactgtctacgacagcaagaggggcgccgtgggcttcttcagtgcaggaacc
tatgtctgcaaggccctcgtcaatggagaggagcacctcagtgaggagtacatcgtccac
ggctgggcaggggggtcggagctgcgtgtggagctgaaggccctgaagactgctctcttg
gtgggagacaccatcactgtcacctgtgtggcccgggggtctgagatactggaagaccac
tggaagtaccctggaaaactggtgaaccgtggcttgaagtcggtgcgtgagaataagagg
gaccaggagatccagtacatcatgactgtcccccaggcctcagccaaagacagcggcatc
tacgcctgctccattactgacatcatcagcaatgagagccagaccaaggagctggccatc
actgtctatgagagcccatttgtgtcgctgcgccctgtgttcagttctcaggagtcagca
gacctggatgagagcagagagttccgggccgacatcgactcattccccagcgcccaggtc
acatggctcaaagatggcctccccctcaactatgtggcggctgagataaccaacagcctc
cagcagctcagcgagaccaggtacctgagtgttctgaccctgatccgggccaaggaggag
gacagtgggaactacaccatcagagtgcagaacgggaaccagacccacagccacagcttc
agtctgcaggtcaaagtacctgcagtcattgtggacctgatggacctccaccatggctca
gcctcaggccagtctgtagtgtgtatcgctggaggcatgcccactcctgaggtggagtgg
ttcatctgcaagaacataaaacactgcgccaatgactcatctcagtgggtgcccctgcca
accaacgacacagatatcactgtggaagcgcattttgatcaggacaaccagctggagagc
caggtgatcttkgtgcgtcttgagaacactctggccgtccgctgcctggccaggaacgag
atggccgccgtcagcagggaggtgaagctggtgtcacaaggcccccactctgagctgcct
gtaactgctgctgttttggtgctgctggtcattgtcatcatctcactcattgtcctggtc
attatctggaaacagaagcctcgctatgagatccgctggagggtgatagagtcagtgagc
cctgatggccatgagtacatctatgttgaccccatgcaactgccctatgactccagatgg
gagttctctcgcgatgggctcgtactgggtcgtgttctgggctctggggcgtttgggaag
gtggtggagggaactgcatatggactcagccgctcccagcccgtcatgaaggtggctgtg
aagatgctgaaacccacggcccgctccagtgagaaacaggccctgatgtcagagctgaag
atcatgactcacctgggccctcacctcaacatcgtcaacctgctgggggcctgcaccaag
tcaggccccacctacatcatcactgagtactgcttctatggagacctggtcaactacctg
cacaagaacagagagaacttcctcagcttgcactcagagaagagcaagaaagacctggac
atctttggcataaaccctgcagatgagagcagcaggagctatgtgatcctgtcctttgaa
agtggtaagggggactacatggaaatgaagcaggcagacaccacgcagtacgtgcccatg
ctggagatgagtgatgcctccaagtactccgacatccagaggtctgaatatgaccaccca
ccatcacagaagggtgataatgagatggacaacctgctgtcagaagacggcaacgagggc
ctcagcaccacagatctgctcagctttacctaccaggtggccagaggcatggagttcctg
tcctctaagaactgtgtgcatcgggacctggctgctaggaacgtcctgctctctcagggg
aagatagtgaagatctgtgactttggcctggccagagacatcatgcatgacaacaactat
gtctccaaaggcagcaccttcctgccagtgaagtggatggctcctgagagtatctttgac
aacatgtacaccaccctcagtgatgtctggtcctacggcatcctcctctgggagattttc
tctctaggtggcaccccatacccagggatggtagtggactccagcttctacaacaagatc
aagagtggctacaggatggccaaacctgagcacgcccccgctgatgtgtatgagatgatg
ataaagtgttggaacagtgagcctgagaagaggccttccttcctcagcctgagtgagagt
gtggcttcactgctgccctccggctacaagaggtgcttcgagagggcaagccatgagttc
ctgaagagcgaccatccagcagtgaccagggtccaggtggagagtgatgacacctacatt
gggatcacctataagagtcaggacaagttgaaggacagggagagtggcttcgacgagcag
cgcctcagctctgacagcggttacattatccccctccccgacctggaccctctgtctgat
gatgagtacgtcaagaggaaccgccacagctctcagacatctgaagagagtgccatagag
acaggctccagcttcacgctggccaagagagaaggagagaccctggaggacatcagcttg
ttggatgagatgtgtttggactcagagctggtggaagacagtttcctgtga

DBGET integrated database retrieval system