KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251212
Entry
112251212         CDS       T05605                                 

Definition
(RefSeq) insulin receptor-like
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
otw04520  Adherens junction
otw04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251212
   04068 FoxO signaling pathway
    112251212
   04150 mTOR signaling pathway
    112251212
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112251212
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112251212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112251212
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112251212
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112251212
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   112251212
CD molecules [BR:otw04090]
 Proteins
  112251212
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 B2
Other DBs
NCBI-GeneID: 112251212
NCBI-ProteinID: XP_024277832
LinkDB
Position
1
AA seq 1361 aa
MRLGTSAVVLVTFIYIGCQCVLTNGEICQSKDIRNNVTNLQLLENCTVIEGHLKILLMFK
AKPEDFRGLSYPKLTVVTDFLLLFRVYGLESLSNLFPNLTVIRGNNLFFNYALVLFEMVD
LKELGLQSLMNITRGAVRVEKNPDLCYLSTLDWSKILDTVEDNYIVANKNDRECGDVCPG
TAYGKTTCPQTTINGHFGERCWTQNHCQRMCPSTCKHRACTQHGHCCHDQCLGGCLEAGK
ASSCVACQNLQHQDTCVDHCPQGYYIFKGWRCVSLSFCQDLHNQCKNGKSSDCHEYVIHN
KACIPECPSGYTTINSTALTCTPCAGLCPKMCTGLKTVDSVTAAQALRGCTVLNGSLIIK
IRGGNNIAAELEANLGQLEEITGYLTIKRAYALVSLSFLRKLHIIRGEMLTQDGNYSFYA
LDNQNLRQLWDWNKHNLTILQGRMFFLHNAKLCMSEIRKMEEVTGTKGRDIKNEIAGRTN
GDQASCENQVLKFTTVRTQSDKILIKWEPFWPPDFRDLLGFMVLYKEAPYKNVTEFDGQD
ACGSNSWVIADIDPPPRASEGKEQGEPGYLIHTMKPYTQYAIMVKTQLSASDEHQVLGAK
SEIIYVRTNATKPSVPLDPISSSNSSSQIILKWKPPTDANGNITHYLVFCQQQPEDSDLY
KFDYCQKGMKLPSRVPTHLDTDEEQKWNQTDESGPGNRCCACPKTDTQLKKEAEESEYRK
TFENYIHNEVFKVRPSRRRRSVGVANATLPHFLTTPPTLPNASTTPSPEGEGVEGSKVTL
VVYAKESTVISNLRHFTSYQIEIHACNHPTDPQRCSMATYVSARTMPEKKADDIVGQVTH
EMVSEHPESVHIKWLDPKAPNGMIILYEVNYKRLGDLEELHHCVSRKAYTQIGGCRLRVV
HPGNYTVRIRATSLAGNGSWTEPTFFFMPDKDTTSLKIIIGSVICFILLLFVGGGVFMIF
KKKQTEGPTGPLIASSNPEYLSANDMYVPDDWEVAREKINILKELGQGSFGMVYEGIAKD
IVKGEPDTRVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGVVSKGQPTLVVME
LMTHGDLKSFLRCLRPDSENNPTGKPPPTLKEMIQMAGEIADGMAYLNAKKFVHRDLAAR
NCMVAEDNTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFG
VVLWEVSTLAEQPYQGLSNEQVLKFVMDGGYLDKPENCVERIHNLMSMCWQYNPKMRPTF
QEIIEMLKEDVHPSFQEVSFFYSEENKLPETEEFDLDLENMESIPLDPSSYSQREDSDSV
SRDNGSSQNLRGNYEEHVPYAHMNGGKKNGRILSLPRSSPS
NT seq 4086 nt   +upstreamnt  +downstreamnt
atgcggcttgggacttcagcggttgttttggttacttttatctacattggatgtcagtgt
gtcctaacaaatggagaaatctgtcagagtaaggatatccgtaacaacgtgaccaacctg
cagttattagagaactgcacagtaattgagggccacttgaagatcctcctcatgttcaag
gccaagcccgaggacttcaggggcctcagctaccccaagctgaccgttgtcaccgacttc
ctcctcctatttagggtctatggtctagagtccctcagcaatctgttccccaacctgacg
gtgatccgaggcaacaacctgttcttcaactacgccctggttctgtttgagatggtggac
cttaaggagctggggctccagagcctcatgaacatcacccggggagccgtgagggtggag
aagaacccggacctctgctacctctccaccctggactggtccaagatcctggacacagtg
gaggacaattacatcgtggccaataagaatgaccgggagtgtggggatgtgtgcccaggc
acggcctatgggaagaccacctgtcctcagactaccatcaatggacactttggagagcgc
tgctggactcagaaccactgccagagaatgtgtccctccacctgtaagcatcgggcctgt
acccagcatggccactgctgccacgaccagtgcctgggaggctgcttggaggcaggcaaa
gccagcagctgtgtggcctgccagaacctccagcaccaggacacctgtgtggaccactgt
ccccagggatactacatcttcaagggctggcgctgcgtctctctctccttctgccaggac
ctccacaaccagtgcaagaatggaaagagcagcgactgccatgagtacgtcatccacaac
aaagcctgcatcccagagtgcccctcagggtacaccaccatcaactctaccgcgttgacc
tgtaccccgtgtgcggggctgtgtcctaagatgtgtacagggctgaagacagtggactct
gtgacagcagcccaggctctgagaggatgcactgtgctcaacggcagcctgatcatcaag
atccgtggagggaacaacatagcagcagagctggaggctaacctgggtcagctggaggag
ataacaggctacctgaccatcaagagagcctatgcccttgtctctctctccttcctccgc
aagctacacatcatccgtggagagatgctgacccaagatgggaactactcgttctacgcg
cttgacaaccagaacctgcgtcagctgtgggactggaacaaacacaacctgaccatcctt
caggggcgcatgttcttccttcacaacgccaagctgtgcatgtctgagatccgcaagatg
gaggaggtgacgggcaccaaggggagagacatcaagaatgaaatcgccggcaggaccaat
ggagaccaggcctcctgtgagaaccaggtgctgaagttcaccacggtgcgcacgcagtca
gacaagatcctcatcaagtgggaacccttctggcctcctgacttcagagacctactaggc
ttcatggtcctctacaaagaggcgccctataagaatgtgacagagtttgatggccaggat
gcgtgtggctctaacagctgggtgatagctgacatagaccctccaccccgggcctcggag
gggaaggagcagggagagcctggctacctcatccatactatgaaaccctatacccagtac
gccatcatggtcaagacccagctctccgcctcagatgaacaccaggtcctcggggccaag
agtgagatcatctacgtccgcaccaatgccaccaagccgtcggtgccgctggaccccatc
tcatcatccaactcgtcctctcagatcatcctgaagtggaagccccccacggacgccaat
ggcaacatcactcactacctggtgttctgtcagcagcagcccgaggacagcgacctctac
aagtttgactactgtcaaaaaggaatgaagctgccgtcgcgggtgcctacccatctggac
actgacgaggagcaaaagtggaaccagacagacgagtctgggccagggaaccgctgctgt
gcctgccccaaaacagacacccagctcaagaaggaggctgaggagtctgagtaccgcaag
acctttgaaaactacatccacaatgaagtgtttaaagtcagaccgtctcgtcggcgccgc
tcagtgggcgtggccaacgccacccttccgcacttcctgaccactccccccaccctgccc
aacgcgtccaccacgcccagcccagaaggcgagggggtggagggctctaaggtgacgttg
gtggtgtatgccaaggagtcgaccgtcatctccaacctgcgtcactttaccagctaccag
atagagatccatgcctgcaaccaccccacagacccccaacgctgcagcatggctacctac
gtcagcgcccgcaccatgcccgaaaagaaagctgatgacattgtgggccaggtgacccat
gagatggtgtcggagcacccagagtctgtccacatcaagtggctggaccccaaagccccc
aatggcatgatcatcctgtacgaggtcaactacaagaggttgggagaccttgaggagctg
catcactgcgtgtccaggaaggcctacacccagatcggcggctgcaggctgagagtggtg
catcctgggaactacaccgtgaggatacgtgccacatcgctggcaggaaacggctcctgg
accgaacccaccttcttcttcatgcccgacaaggacaccacttcactgaagattatcatt
ggctcagttatctgcttcatcctgctgctattcgtaggaggtggagtcttcatgatcttc
aagaagaaacaaactgagggacccactggacctctgatcgcctcgtccaacccagagtac
ctgagcgccaatgacatgtacgtgcctgatgactgggaggtggcgagggaaaagatcaac
atcctcaaggagctgggtcagggctcatttggcatggtctacgagggcatcgccaaggac
attgtgaagggcgagccggacacgcgtgtggcggtgaagacggtcaacgagtcggccagt
ctgagagagaggatagagttcctcaatgaagcgtcggtcatgaaggcctttagctgccac
cacgtggtgcgtctgctgggggtggtgtctaaaggccagcccactctggtggtgatggag
ctgatgacccacggggatctgaagagcttcctgcgctgcctccgaccagactctgagaat
aaccccacagggaagccccctcccacactgaaggagatgattcagatggcgggggagata
gcagacggcatggcctacctcaacgccaaaaagtttgtccacagagatctggccgccagg
aactgcatggtggctgaggacaacaccgtcaagatcggagactttggcatgaccagagac
atatatgagacggattactaccgtaagggagggaagggtctgcttcctgtcaggtggatg
gctcctgaatctctgaaggacggagtgttcaccgcacattcagactgctggtcatttggt
gtggtattgtgggaggtcagcaccctagcagagcagccttaccaaggcctgtccaacgaa
caggtcctcaagttcgtcatggacggaggatacctagacaaaccagagaactgcgtagag
aggatccacaacctgatgtcgatgtgctggcagtacaaccccaagatgcgtcccaccttc
caggagatcatcgagatgttgaaggaggatgttcaccccagcttccaggaggtctccttc
ttctacagcgaggagaacaagctccccgagacagaggagtttgacttggacctggagaac
atggagagcatcccactggacccatcgtcctactcccagagagaggacagcgacagtgta
tccagagacaatggatccagccagaacctaaggggcaactatgaggaacacgtgccctac
gcacacatgaacggtggcaagaaaaacggacgaatcctatcattgccgagatccagccct
tcctaa

DBGET integrated database retrieval system