KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251290
Entry
112251290         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK2-like
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04310  Wnt signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251290
   04310 Wnt signaling pathway
    112251290
   04068 FoxO signaling pathway
    112251290
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112251290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112251290
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112251290
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112251290
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH FTA2
Other DBs
NCBI-GeneID: 112251290
NCBI-ProteinID: XP_024277973
LinkDB
Position
1
AA seq 476 aa
MAFHGTGRQQTVCGNLFPGSELGHKYFCVNTSTGATSTGLTATPSLTGPTAPAGTPRHPT
SLGGSTGGGAAVPQPHSSPASEVPSPAEMEPDRPIGYGAFGVVWSVTDPRDGRKVALKKM
PNVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKV
IVSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVE
EPDPSRHMTQEVVTQYYRAPEVLMGSRHYGSAIDVWSVGCIFAELLGRRILFQAQSPIQQ
LDLITDLLGTPPLSAMASACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLV
FDPAKRISGSDALSHPYLDEGRLRYHTCMCQCCYSVPSGRVYTRDFEPPADRNFSHSYDN
SLLSVWQGKELIHRFITEHQQGKRVPLCINPQSAAFKTFIRSTAWHSSKVSRKEER
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcattccatggtacaggccggcagcagacagtatgtggtaacctgttccccggatct
gagttaggccataagtatttttgcgtcaacacctcaactggagccacttccacgggcctc
actgcaactccgagtctaactggacccactgccccggcggggacgccacgacatccaaca
tctcttgggggaagcaccggcggcggggccgctgtaccacagcctcatagtagtcctgcc
agtgaagtaccaagccctgctgagatggagcctgatcgacctatcggttatggcgcattt
ggtgtggtctggtcagtgacagaccctcgtgacgggcgtaaggtagccctgaagaagatg
cccaatgtcttccagaacctagtctcctgtaagagggtcttcagagagctgaggatgctc
tgcttcttcaagcacgacaacgtgttgtcagcgctggacattctgcagcctccacagatc
gactgcttcgaggaaatctacgtgatcactgagctgatgcagagtgacctccacaaagtc
attgtgtctccccagcccctcaccaccgaccacatcaaggtgttcctctaccagatcctc
agagggctgaagtacctgcattctgctggcatcctgcacagggacatcaaacctgggaac
ctgttagtcaacagcaactgcctgctcaagatctgtgactttgggcttgcacgtgtggag
gagccggacccatctcgtcacatgacccaggaggtggtgactcagtactaccgggctcct
gaggtgctgatgggcagccgccattacggctctgccatagacgtctggtcggtgggctgc
atcttcgctgaactactgggtcgacgcatcctgttccaggcccagagccccatacaacag
ttggatctgatcactgatctgctgggtacccctcctctctctgccatggcatctgcctgt
gagggggccagagctcacatcctgagaggacctcacaaaccgccgtcgctctctgtgtta
tatatgctgtcggacggggcgacccacgaggccgtgcacctgttgtgtcgtatgctggtg
tttgatccggccaaacggatctcaggcagcgacgccctctcccacccctacctggacgag
ggccgtctgcgctaccacacgtgcatgtgtcagtgctgctactccgtgcccagcgggcgt
gtgtacacgcgtgactttgaaccgcccgccgaccggaacttcagccacagctacgataac
agcctgctctctgtctggcagggcaaagagctcatccatcgcttcataacagagcaccag
caggggaaacgagtgccgctgtgcatcaacccccagagtgccgccttcaagaccttcatc
aggtctactgcgtggcattcctccaaagtctccaggaaggaggagagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258406
Entry
112258406         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK2-like isoform X1
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04310  Wnt signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112258406
   04310 Wnt signaling pathway
    112258406
   04068 FoxO signaling pathway
    112258406
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112258406
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112258406
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112258406
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112258406
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 112258406
NCBI-ProteinID: XP_024288530
LinkDB
Position
9
AA seq 477 aa
MAFHGTGLQQTVCGNLFPGSELGHNKYFCVNTSTGTTSTGLSATPSLTGPTTPAGTPRHP
TSLGGSTGGGAAVPQPHSSPASEVPSPAEMEPDRPIGYGAFGVVWSVTDPRDGRKVALKK
MPNVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHK
VIVSPQPLTTDHIKVFLYQILRGLKYLHSASILHRDIKPGNLLVNSNCLLKICDFGLARV
EEPDQSRHMTQEVVTQYYRAPEVLMGSRHYGSAIDVWSVGCIFAELLGRRILFQAQSPIQ
QLDLITDLLGTPPLSAMASACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRML
VFDPAKRISGSDALSHPYLDEGRLRYHTCMCQCCYSVPSGRVYTRDFEPPADRNFSHSYD
NSLLSVWQGKELIHHFITEHQQGKRVPLCINPQSAAFKTFIRSTAWHSSKVSRKEER
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggcattccatggtacaggcctgcagcagacagtatgtggtaacctgttccccggatct
gagttggggcataacaagtatttttgcgtcaacacctcaactggaaccacttccacgggc
ctcagtgcaactccaagtctaactggacccactaccccggcggggacgcctcgacacccg
acgtctcttgggggaagcaccggtggtggggcagctgtaccacagcctcatagtagtcct
gccagtgaagtgccaagccctgctgagatggagcctgatcgacctatcggttatggcgca
tttggtgtggtctggtcagtgacagaccctcgtgacgggcgtaaggtagccctgaagaag
atgcccaatgtcttccagaacctagtctcctgtaagagggtcttcagagagctgaggatg
ctctgcttcttcaaacacgacaacgtgttgtcagcgctggacattctgcagcctccgcag
atcgactgcttcgaggaaatctacgtgatcactgagctgatgcagagtgacctccacaaa
gtcatcgtgtctccccagcccctcaccaccgaccacatcaaagtgttcctctaccagatc
ctcagagggctgaagtacctgcattctgctagcatcctgcacagggacatcaaacctggg
aacctgttagtcaacagcaattgcctgctcaagatctgtgactttgggctggcacgtgtg
gaggagccggaccagtctcgtcacatgacccaggaggtggtgactcagtactaccgggct
cctgaggtgctgatgggcagccgccattatggctctgccatagacgtctggtcggtggga
tgcatcttcgccgaactactgggtcgacgcatcctgttccaggcccagagccccatacaa
cagttggatctgatcactgatctgctgggtacccctcctctctctgccatggcatctgcc
tgtgagggggccagagctcacatcctgagaggacctcacaaaccgccgtcactctctgtg
ttatacatgctgtcggacggggcgacccacgaggccgtgcacctgttgtgtcgtatgctg
gtgtttgatccggccaaacggatctcgggcagcgacgccctctcccacccctacctggac
gagggccgtctgcgctaccacacgtgcatgtgccagtgctgctactcggtgcccagcggg
cgtgtgtacacgcgggactttgaaccgcccgccgaccgcaacttcagccacagctacgat
aacagcctgctctctgtctggcagggcaaagagctcatccatcacttcataacagagcac
cagcaggggaaacgagtgccgctgtgcatcaacccccagagtgctgccttcaagaccttc
atcaggtctactgcgtggcattcctccaaagtctccaggaaggaggagagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265656
Entry
112265656         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04310  Wnt signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265656
   04310 Wnt signaling pathway
    112265656
   04068 FoxO signaling pathway
    112265656
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112265656
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112265656
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112265656
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112265656
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like FTA2
Other DBs
NCBI-GeneID: 112265656
NCBI-ProteinID: XP_024298947
LinkDB
Position
13
AA seq 526 aa
MALCGTTAANAANMMAAYNGGASAVAAHHPHHHHQLPHLPPPHLHHHHHPGQHHLQHPGS
AAAVHPVQQHASTAAAAAAAAVMLNPSQQQPYFPSPAPGQAPGPAAAAAPAQVQAAAVKA
HHHHHQHSHHLQPQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKR
VFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHV
KVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARLEELDESRHMTQEV
VTQYYRAPEILMGSHHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPS
LEAMRTACEGARAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDRSKRISAKDA
LAHPYLDEGRLRYHTCMCKCCYTTSSGRVYTSDFEPVTTPKFDDGFEKNLTSVRQVKEII
HQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggctttgtgcggaacaacggctgccaatgccgcaaacatgatggctgcatacaacggt
ggcgcctcggcagttgctgcccatcacccgcaccatcaccaccaactaccgcatctccca
cctccccatctccaccaccatcaccacccgggccagcatcacttgcaacaccccggatct
gccgccgctgtccaccctgtacaacaacacgcttctacagcagcagctgcagcggcagcc
gcggtaatgctgaacccgagccagcaacaaccatactttccctcgccagctcctggacaa
gcccccggtccggcagcggcagcggcacctgcccaagttcaagctgcggctgtcaaagct
caccaccaccatcatcaacactcgcaccacttacagccgcagttggacatagagcccgac
agacccatcggctatggagcttttggggtggtctggtcagtgacggacccccgggatgga
aagcgcgtcgccctcaaaaagatgcccaacgtcttccagaacctcgtctcctgtaagagg
gtcttccgcgagctgaagatgctgtgcttcttcaaacatgataatgtgctctcggctctc
gacatcctacagcctccacacatcgactactttgaggaaatctatgtggtgacagaactg
atgcagagtgacctccataagatcatcgtgtcacctcaacccctcagctcagatcacgtc
aaagtgtttctctatcagatcctccgaggactgaagtacctgcactcagctggcatccta
catcgagacatcaaacctggcaacctcctggtcaacagcaactgtgtgcttaagatctgt
gactttgggctggcgcggttggaggagctggacgagtctcgtcacatgactcaggaggtg
gtgacacagtattaccgtgcgccagaaatcctcatgggcagccaccattactccaacgcc
atcgacatctggtctgtaggatgcatctttgccgagctactgggccgacgcatcctgttc
caggcacaaagtcccatccagcagctggatctgatcacggacctgctgggcactccctct
ctggaggccatgaggacagcgtgtgagggagccagggcccacatcctcagaggaccacac
aaacagccatcccttcctgtcctgtacaccctgtccagccaggccacccatgaagctgtc
cacctcctgtgcaggatgcttgtgttcgatcggtcgaagcggatttcagcgaaggatgcc
ctggcccacccctacctggacgagggcagactgaggtaccacacctgtatgtgtaagtgc
tgctacaccacctcctctggtcgcgtctacaccagcgacttcgagcccgtcaccacaccc
aagttcgacgatggctttgagaagaatctgacctccgtcagacaggtcaaagagatcatt
caccagttcatcctggagcagcagaaggggaacagagtgccgctctgcatcaacccccag
tcagctgctttcaaaagctttatcagttccactgtggcccagccctctgagatgcccccg
tcccccctggtgtgggaatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267223
Entry
112267223         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase NLK-like
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04310  Wnt signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112267223
   04310 Wnt signaling pathway
    112267223
   04068 FoxO signaling pathway
    112267223
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112267223
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112267223
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112267223
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112267223
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like FTA2
Other DBs
NCBI-GeneID: 112267223
NCBI-ProteinID: XP_024301212
LinkDB
Position
14
AA seq 520 aa
MALCGTTAANAAKMMAAYNGGASAVSAHHPHHHHQLPHLPPPHLHHHHHPGQHHLQHPGS
AAAVHPVQQHASTAAAAVMLNPSQQQPYFPSPAPGQAPGPAAAAAPAQVQAAAVKAHHHH
QHSHHLQPQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFREL
KMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLY
QILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYY
RAPEILMGSHHYSNAIDIWSIGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMR
TACEGARAHILRGPHKQASLPVLYTLSSXATHEAVHLLCRCVFDPSKRISAKDALAHPYL
DEGRLRYHTCMCKCCYTTSSGRVYTSEFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILE
QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggctctgtgcggaacaacggcagccaatgccgcaaaaatgatggctgcatacaacggt
ggcgcctcggcagtttctgcccatcacccgcaccatcaccaccaactaccacatctccca
cctccccatctccaccaccatcaccacccaggccagcatcacttgcaacaccctggctct
gccgccgctgttcaccctgtacaacagcacgcttctacagcagctgccgcggtaatgttg
aacccgagccagcagcaaccatactttccctcgccagctcctggacaagcccccggtccg
gcagcggctgccgcacctgcccaagttcaagctgcggctgtcaaagctcaccatcaccat
caacactcacaccacttacagccgcagctggacatagagcccgacagacccatcggctat
ggagcttttggggtggtctggtcagtgacggacccccgggatggaaagcgagtcgccctc
aaaaagatgcccaacgtcttccagaacctcgtctcctgtaagagggtcttccgtgagctg
aagatgctgtgcttcttcaaacatgataatgtgctctcggctctcgacatcctacagcct
ccacacatcgactactttgaggaaatctatgtggtgacagaactgatgcagagtgacctc
cataagatcatcgtgtcacctcaacccctcagctcagaccacgtcaaagtgtttctctat
cagatcctccgaggactgaagtacctgcactcagctggcatcctacatcgagacatcaaa
cctggcaacctcctggtcaacagcaactgtgtgcttaagatctgtgactttgggctggcg
cgggtggaggagcttgacgagtctcgtcacatgactcaggaggtggtgacccagtattac
cgtgcgccagagatcctcatgggcagccaccattactccaacgccatcgacatttggtct
ataggatgcatcttcgccgagctactgggccgacgcatcctgttccaggcacaaagcccc
atccagcagctggatctgatcacggacctgctgggaactccatctctggaggccatgagg
acggcgtgtgagggagccagggcccacatcctcagaggaccacacaaacaggcatccctt
cctgtcctgtacaccctgtccagcnnagctacccacgaagctgttcacctcctgtgcagg
tgcgtattcgatccgtctaaacggatctcagcgaaggatgccctggcccatccttacctg
gacgagggcagactgaggtaccacacctgtatgtgtaagtgctgctacaccacctcctct
ggtcgcgtctacaccagcgaattcgagcccgtcaccaaccccaagttcgacgatggcttc
gagaagaatctgacctccgtcagacaggtcaaagagatcattcaccagttcatcctggaa
cagcagaaggggaacagagtgccgctctgcatcaacccccagtcggccgctttcaaaagc
tttatcagttccactgtggcccagccctctgagatgcccccgtcccccctggtgtgggaa
tag

DBGET integrated database retrieval system