KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251388Help
Entry
112251388         CDS       T05605                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00590  Arachidonic acid metabolism
otw01100  Metabolic pathways
otw04370  VEGF signaling pathway
otw04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112251388 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112251388 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112251388 (ptgs2)
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     112251388 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF DctM
Motif
Other DBs
NCBI-GeneID: 112251388
NCBI-ProteinID: XP_024278113
LinkDB All DBs
Position
5
AA seq 609 aa AA seqDB search
MNRIISALLFLPLGIIFVCEGGNPCCSQPCLNRGVCTAMGSEDYECDCTRTGFYGHNCTQ
PEFFTWIKVSLKPTPNTVHYLLTNYKGVWNIINSISFLRDAIMRYVLTSRSHLIDSPPTF
NADYNYKSWEAYSNLSYYTRTLPPLPKDCPTPMGVVGKIELPDAKMLAEKLLIRRKFIPD
PQGSSLMFAFFAQHFTHQFFKSDQKMGPAFTKAKGHGVDLGHIYGENLERQHKLRLFKDG
KLKFQVLDGEVYPPTVKEVGADMHYPPHVPESHRFAVGHEAFGLVPGLMMYATIWLREHN
RVCDVLKEVHPDWDDDRLFQTSRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFKER
FQYQNRISSEFNTLYHWHPLMPDAFHIQEQVYSYPQFVFNTSVVTTHGISNLVASFTKQI
AGRVAGGRNVPPAVMMVALKSIENSRQMRYQSLNAYRKRFSMKPYASFEDLTGEKEMAAE
LEEMYGHVDAVELYPGLLVEKPRTNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTF
GGSVGFDIINTASLQRLVCSNVKGPCPVASFHVPDVEDNRSNTINSSTAQSGSNDVNPTV
LLKERTTEL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcatatctgcgcttctatttctgcctctgggcataatatttgtctgcgaa
ggaggcaacccttgctgttcacagccatgcctgaaccgcggagtgtgtactgccatgggc
tcagaagactatgagtgcgactgcacacgcactggattctatggccacaactgcacacaa
cctgaatttttcacgtggattaaagtgtctctgaagcctaccccaaacacagtgcattac
ctcctcaccaactacaagggggtctggaacatcatcaatagcatttcattcctcagggat
gctatcatgagatatgttctgacatcccgctctcatctgatcgacagtccaccgaccttc
aatgcggactataattataaaagctgggaagcctactccaacctgtcctactacacacga
accctccctcctctgcccaaggattgcccaacccctatgggagtcgtaggtaagatagag
ctacctgatgctaagatgctggctgagaagctcctgatcaggaggaaatttatccccgac
ccccagggttccagcctgatgtttgcttttttcgcccaacacttcacccaccagtttttc
aaatctgaccagaagatggggccggcatttactaaagccaagggccacggggtggacctt
ggtcacatctacggggaaaaccttgagaggcaacataaactgcggctcttcaaggatggc
aagctgaagtttcaggtgctggatggagaggtgtacccacctacagtgaaagaggttggg
gctgatatgcactaccctccccatgtccctgagtctcaccgcttcgctgtgggccatgag
gcgttcggcctggtgcctggtctcatgatgtacgctactatctggctgagggaacacaac
cgcgtctgtgatgtcctgaaggaggtccatccagactgggatgatgataggctcttccag
acatcacgcctcattctcattggtgagaccatcaagattgtgattgaggactacgtgcag
cacctgagcggctacaacttcaagctgaagttcgacccggagcttctcttcaaagagcgt
ttccagtatcagaaccgcatctcgtcagagttcaacaccctgtaccactggcacccactg
atgcctgatgccttccacatacaggagcaggtctactcctacccccagtttgtcttcaac
acctccgtggtcaccacacacggcatctccaacctggtggcgtcctttaccaagcagatc
gctggacgggttgctggaggtcgtaacgtcccccctgcagtgatgatggtggctctgaag
tccatagagaacagcagacagatgcgctaccagtccctcaacgcctacaggaaacgtttc
tccatgaagccatatgcctccttcgaagacctcacaggagaaaaggagatggctgcagag
ctggaggagatgtatgggcatgtggatgctgtggagctctacccaggtctgctggtggag
aagcccagaaccaatgccatctttggggagaccatggtggagatgggtgccccctactcc
ctgaaaggcctgatgggaaaccccatttgttcaccagagtactggaagcccagcaccttt
ggcgggagcgttggctttgacatcatcaacaccgcgtccttgcagaggctagtgtgcagc
aacgtcaagggcccgtgccctgtggcgtcctttcatgtgcccgacgtagaagacaataga
tccaataccatcaattccagtacagcacagtcggggagcaacgatgtcaatcccacagta
cttctgaaagaaaggaccactgagctctga

DBGET integrated database retrieval system