KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251778Help
Entry
112251778         CDS       T05605                                 

Definition
(RefSeq) IQ and AAA domain-containing protein 1-like
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ Holin_BhlA Imm-NTF2 TsaE
Motif
Other DBs
NCBI-GeneID: 112251778
NCBI-ProteinID: XP_024278486
LinkDB All DBs
Position
5
AA seq 823 aa AA seqDB search
MSHSTYNKLWADAQVELNSLLTQEFPAQPPRPEKDRVVFFQRLATLYVRYVQIFRQLEEA
YDQVVHPQKRKVIREVLDGVMGRVLELKNEMVEKEFSEYHYMDDVIQDLKLTPEDIEIPI
PRYFLSERSKVLQERRNMLSNILNLIEVVERPKPVGVRALNLEEAIKIIQVSERARQGRL
RAKFMREIQRDEERQRRAKDRDLGAAAIDTAVVRIQKVWKGYVQRKRTKREREEEMIFLG
MAMEPRHTQPCPAITAALANEARRRGKQEEHEEDYQKSIVAITDKLREVEGPDMRETMKD
QIRQWFIECHDATGTFPDYPEEEDGGSTLIFAEKTPQQLMEELAAKDEEDANKSTKGKEE
KKDKGKKDKGKGGDEEEESGLKMLPSAFLGELEVGHKTFGEVWQNRTESKNFSQRHEAEL
IKEEKRKEIEVEIRLQVDELMRQELANWKLAVDKDKGGKAKGGAKKKKGSKSGKKKKKDK
DLTADRNIESLYQELVEQGLLKQSDNVKLQDYLGDYSYLGTTLRQTDIEPMPSLSDVRQV
IALYAVLPLGSQVVHEKAPLVKAILLAGPAGVGKKMLVHAICQETGANLFDLSPLNLAGK
YPGKSGLAMMLHMVFKVARLLQPSVVWIGDTEKMFYKKVPKEEKELDPKRLKKDLPKILK
SIKGEDRVLVVGTTHDPFNADLKSLCKVYSKIILIPRPDYASRYVMWRQLIKKNGGQVTA
ALDLSSLAKISDGYTQGHMVQVVQSILTERRVQQLAKRPLGAAEFVAPLAKIDPVFQDEE
EALKNWYAKTPLGKKRAKAASGKEGEEEAPTKGGKDAKKKGKK
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacagtacatacaacaaactgtgggctgatgcccaggtcgagttgaactccctt
ctgactcaggagttccctgctcagcctcctcgcccagagaaggaccgagtggtgttcttc
caacgcctggccaccctctacgtgcgctatgtgcagatcttcaggcagctggaggaggcc
tatgaccaggtggttcatccccagaagaggaaagtgatccgggaggtcctggatggcgtg
atggggcgggtgctggaactcaagaatgagatggtggagaaagagttctctgagtaccat
tacatggacgatgtcatccaggacttgaagctcacgcctgaggacattgagatccccatc
cctcgatatttcctcagtgaacgcagcaaggtgttgcaggagagacggaatatgctctcc
aacatcctcaacctcatcgaggtagtagagcgacccaaacctgtaggagtgcgtgcactg
aacctggaggaagccataaagatcatccaggtgtcagagagggcccgtcagggtcgcctg
agggccaagttcatgagggagatccagcgcgatgaggaaaggcagaggagggccaaggac
agggacctgggggcagcggccatcgacacggcggtggtccgcatccagaaggtgtggaag
ggttatgtgcagaggaaaagaacaaagagggagcgagaggaagagatgatatttttgggc
atggccatggagcccagacacacccagccctgtcctgccataacagctgccctggccaac
gaggcccgtcggagaggcaagcaggaggagcatgaggaggactaccagaagtccattgtg
gccatcacagacaaactaagagaggtggaggggcccgacatgagggagactatgaaggac
cagatcagacagtggttcatcgaatgccatgatgcaacaggaactttccctgactaccca
gaggaggaggatggaggctcgactctcatctttgcggagaaaacacctcaacagttaatg
gaggaactagcagcgaaagatgaggaggacgccaacaaaagcacgaaagggaaggaggag
aagaaggacaaagggaagaaagacaagggaaagggaggagatgaggaggaggaatctggg
ctaaagatgttgccgtctgctttcctaggagaactggaagtaggacacaagacctttggt
gaggtgtggcagaatcgtaccgagtccaagaacttcagccagaggcacgaggctgagctg
atcaaggaggagaagaggaaggagattgaggtggagatcaggttgcaggtggatgagctg
atgaggcaggagctggctaactggaaactggccgtggataaagataagggtggcaaagcc
aagggaggcgcaaagaaaaagaaagggtcgaaaagtggaaagaagaaaaagaaagacaaa
gatctgacagctgataggaatattgagtctctgtatcaggaactggtggaacagggcttg
ttgaaacaatcagataacgttaaactacaggattatttaggcgactatagctatctgggg
acaacgttaaggcaaactgacattgagcccatgccttcactatctgacgtgagacaagtt
atagctctgtacgccgtcttacctttaggttctcaggtggtccatgagaaggctcctctg
gtgaaggccatcctgctggcagggcccgcgggcgtaggcaagaagatgctggtccatgcc
atctgccaggagacgggcgccaacctatttgatctgtcacctctgaacctggcagggaaa
taccccggcaagagtggcctggccatgatgctccacatggtgttcaaggttgccagactg
ttgcagccatcagtggtgtggattggagatacagagaaaatgttttacaagaaagtaccg
aaggaggaaaaagagttagatccaaaacgcttgaagaaagacttgcccaagatcctcaaa
tcgatcaaaggggaagatcgtgttctagtcgtgggaacgactcatgatccgttcaatgcc
gacctcaaatcactatgcaaggtgtacagcaaaattatcctcattccacgtcctgactac
gcctcacgatatgtaatgtggaggcagttgatcaagaagaacggaggacaggtgacggct
gccctggacctgagctccttggccaagatctctgatggctacacgcagggtcatatggtg
caggtggtgcaaagcatactgacggagcgccgcgtccagcagctggccaagagacccctg
ggcgccgccgagtttgtggccccgctggccaagatcgaccctgtgtttcaggacgaggag
gaggccctgaagaattggtatgctaaaactcctctgggtaagaagcgagccaaggctgcc
tcaggaaaggagggagaggaggaggcaccgacaaagggaggcaaagatgccaagaagaaa
gggaagaagtaa

DBGET integrated database retrieval system