KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252028
Entry
112252028         CDS       T05605                                 

Gene name
prmt1
Definition
(RefSeq) protein arginine N-methyltransferase 1 isoform X1
  KO
K11434  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112252028 (prmt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112252028 (prmt1)
Enzymes [BR:otw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     112252028 (prmt1)
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     112252028 (prmt1)
SSDB
Motif
Pfam: Methyltransf_25 PrmA Methyltransf_11 Methyltransf_23 Methyltransf_9 Methyltransf_31 MTS DOT1 CMAS DUF4382 PCMT PRMT5 Methyltransf_16 Methyltransf_4 Methyltransf_12
Other DBs
NCBI-GeneID: 112252028
NCBI-ProteinID: XP_024278679
LinkDB
Position
1
AA seq 356 aa
MAETTDRMEISQGESSAKPAAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN
KHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKMDHIVTIIK
GKVEEVDLPVEGVDIIISEWMGYCLFYESMLNTVIYARDKWLKPEGLIFPDRATLYVTAI
EDRQYKDYKIHCENSSKFWGWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSSACLIKEV
DIYTVKIDDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSTSPESPYTHWKQT
VFYLDDYLTVKTGEEIFGNINMKPNVKNNRDLDFTVDIDFKGQLCEVSKTSEYRMR
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcggagactacggacagaatggagatttctcagggggagagctcggccaagcctgca
gcagaagacatgacttctaaggactactactttgactcatatgcccacttcggtatccat
gaggagatgctgaaagatgaggtgcgtaccctgacctacaggaactcaatgttccacaac
aagcacctgttcaaggacaaggtggtgttggacgtgggcagtgggactggcatcctctgc
atgtttgcagccaaagccggggctaagaaagtcataggcattgagtgcagcagtatttct
gactatgctgtgaagatcgtcaaagccaacaaaatggaccacattgtgaccatcatcaag
gggaaggtggaggaggtggacctccctgtagagggagtggacattatcatctcagagtgg
atgggctactgcctcttctatgagtcaatgctcaacactgtcatctacgccagggacaag
tggctgaaaccagagggcctgattttcccagacagggctaccctgtatgtcacagccatt
gaggacaggcagtacaaggactataaaatccactgtgagaattcctctaaattttggggg
tgggagaatgtgtacggttttgatatgtcctgcatcaaggaggtggccatcaaggagccc
ctagtggatgtggtggatcccaaacagctggtcagcagcgcctgcctcatcaaggaggtg
gacatctacacagtgaagatcgacgacctgtccttcacctcgcccttctgcctgcaagtg
aagaggaatgattacatccacgctctcgtcacctacttcaacatcgagttcacacgctgt
cacaagaggacaggcttctccaccagtccggagtccccctatacccactggaagcagact
gtattctacctggatgactatctgactgtgaagactggagaggagattttcggcaacatc
aacatgaagcctaatgtcaaaaacaacagagacctggacttcaccgttgatatagacttc
aaaggtcagctctgtgaggtgtccaagacctcagagtacagaatgcgttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252080
Entry
112252080         CDS       T05605                                 

Definition
(RefSeq) protein arginine N-methyltransferase 1-like isoform X1
  KO
K11434  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112252080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112252080
Enzymes [BR:otw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     112252080
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     112252080
SSDB
Motif
Pfam: Methyltransf_25 PrmA Methyltransf_11 Methyltransf_23 Methyltransf_9 Methyltransf_31 MTS DOT1 Met_10 CMAS PRMT5 PCMT Methyltransf_16 Methyltransf_4 Methyltransf_12
Other DBs
NCBI-GeneID: 112252080
NCBI-ProteinID: XP_024278778
LinkDB
Position
1
AA seq 315 aa
MSLRPGPHGIEMAETTDRMEISQGESSAKPAAEDMTSKDYYFDSYAHFGIHEEMLKDEVR
TLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKA
NKMDHIVTIIKGKVEEVDLPVEGVDIIISEWMGYCLFYESMLNTVIYARDKWLKPEGLIF
PDRATLYVTAIEDRQYKDYKIHCENSSKFWGWENVYGFDMSCIKEVAIKEPLVDVVDPKQ
LVSSACLIKEVDIYTVKIDDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSNQ
SRVPLHPLEADCILP
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagtctgcgtccaggaccacacggaattgaaatggcggagacaactgatagaatggag
atttctcagggggagagctcggccaagccagcagcagaagacatgacttctaaggactat
tactttgactcatacgcccacttcggtatccatgaggagatgctgaaagatgaggtgcgc
accctgacctaccggaactcaatgttccacaacaagcacctgttcaaggacaaggtggtg
ttggacgtgggcagtgggactggaatcctctgcatgtttgcagccaaagctggtgccaag
aaggtcataggcattgagtgcagcagtatttctgactatgccgtgaagatcgtcaaggcc
aacaaaatggaccacattgtgaccatcatcaaggggaaggtggaggaggtggaccttcct
gtagagggagtggacatcatcatctccgagtggatgggctactgcctcttctatgagtcc
atgctcaacactgtcatctacgccagggacaagtggctgaaaccagagggcctgattttc
ccagacagggctaccctgtatgtcacagccattgaggacaggcagtacaaggactataaa
atccactgtgagaattcctctaaattttgggggtgggagaacgtgtacggcttcgatatg
tcctgcatcaaggaggtggccatcaaggagcccctagtggacgtggtggaccccaaacag
ctggtcagcagcgcctgcctcatcaaggaggtggacatctacacggtgaagatcgacgac
ctgtccttcacctcgcccttctgcctgcaggtgaagaggaacgattacattcacgccctc
gtcacctacttcaacatcgagttcactcgctgtcacaagaggacgggcttctccaaccag
tccagagtccccctacacccactggaagcagactgtattctaccttga

DBGET integrated database retrieval system