KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252351
Entry
112252351         CDS       T05605                                 

Definition
(RefSeq) breast cancer anti-estrogen resistance protein 1-like isoform X1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252351
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112252351
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2 HisKA
Other DBs
NCBI-GeneID: 112252351
NCBI-ProteinID: XP_024279256
LinkDB
Position
6
AA seq 915 aa
MNYLNILAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKAGQQQSPLPHASQPGPAQSPSQLAFPPQSAYCKPSPSSQYTAMHPAFSNPG
PVPALPDSIYMMPPNHGKPSSSSLYQIPMGPQAPPKAPMLSQKKFHAPVQDIYQVPPSAG
GPGPGQDIYQVPPSLNQTQDIYQIPPSIEKRSWDSSKPLGKVVVPTRVGQVYVYDTGKSE
QDEYDVPPRHLPPSQQSQDIYDVPPTHGQYNQQVYDTPPMVVKGPPSGQDVYDTPPSVDK
SQLFSQQTVYDFPPSVRKDVPDAPIREETYDVPPHFAKLKSLESQSQGYLIPGGPEPPIP
EDVYDVPPPPLTGKRHPDAYHVPLGQEIYDIPASLRKGGHHNPQDVYDFPRERPACEDSI
YDVPPQVVRDAGATEEMTVSFKRLSASSTGSTRSNLSTSSLDMVPVRESAVPSQAGPGKL
LILDLEQAMERLSHLQQEVEGSVSLLMSFISGNWRSPTQMEANLPAIRKAVDRMRVAVRD
LLEFARGAVANSAQATDRTLQAKLGKQVQKMEEAFQGLVKYSQALDAVGWAPSAQMAPLA
GNGGDDLDRLIMCARGVPDDTKQLASFLHGNASLLFKRTNKQQQLPLPHVPHTADLMGQM
TNNNISAYQTGDGRANIQSRPLPSPPKFTAEEETHDRPYETTEEGWMEDYDYVHLQGKEE
FEKNQRQLLEKGTRHNKTTLERQQQLKQFERLEQEVSQPINNDISGWTPPPHYPAAQRSK
LSMGDRQLLLFYSEQCEANVTTLTNAIDAFYSSINNNQPPKIFVAHSKFVILSAHKLVFI
GDTLSRQAKSPEVRAHVAQHSNALCDKLKDIVVSTKTAALQYPSPGAARDMTERVRELAG
CTQQFRMALGQLVAM
NT seq 2748 nt   +upstreamnt  +downstreamnt
atgaactatctgaacattctggctaaggccctgtacgacaatgtggctgagtctccagac
gagctgtccttccggaaaggtgacatcatgacggtactggagcgggacacccagggtctg
gatggctggtggctctgctctctgcatggacgccagggcatcgtccctggaaaccgcctc
aagatcctggtgggcatgtatgacaaggctgggcagcagcagtctcctctcccccatgcc
tcccaacctggccctgcccagagcccgagccagctggccttccccccgcagagtgcctac
tgcaagccctccccctcctcccagtacacagccatgcaccctgccttctccaaccctggg
cctgtccccgccctacctgacagcatctacatgatgccccccaaccatggcaagccttct
tcttcaagcctgtaccagatacccatgggcccccaagccccacccaaggcccccatgctc
tcccagaagaagttccacgctcctgttcaggacatctatcaggtgcctccctcagcagga
gggcctggacctgggcaggatatctaccaggttcccccctcactgaaccagactcaggac
atctaccagatccccccctccatagagaagaggagctgggactcctccaaacctctagga
aaggtggtggtaccaacgcgggtgggtcaggtatatgtgtatgacacagggaagtcagag
caggatgagtatgacgtcccccccagacacctgcctccatcccagcagtcccaggacatc
tatgacgttcccccgacccacggccaatacaaccagcaggtgtatgacacgccacccatg
gtggtgaaaggcccccccagtggccaagacgtctatgacacgccccccagtgtggacaag
agccagctgttctcccagcaaacggtttacgacttccccccctccgtcagraaggatgtt
ccagacgctcctatcagggaggagacctatgatgtccccccccactttgccaagctgaag
agtctggagagccagagccagggctatctgatccccggggggcctgagccccccatccct
gaagatgtgtacgatgtccctccccctcccctcaccggcaagcgccacccggacgcctat
cacgtccccctgggccaggagatctacgacatccctgccagtctgaggaagggcggacac
cataacccccaggatgtgtacgatttcccacgcgagcggcctgcgtgcgaggactccatc
tatgacgtccctcctcaggtggtgagagacgcgggtgccacagaggagatgactgtcagc
ttcaaacgcctgtctgcctccagcacgggcagcacccgcagcaacctgtccacctcctct
ctggacatggtgccagtcagggagtcggcggtgcccagccaggccggcccggggaagctg
ttgatcctagacctggagcaggccatggagcgcctctcccacctacagcaggaggtggag
ggctccgtctccctcctcatgtctttcatcagtgggaactggcgcagccccacccagatg
gaggccaacctgccagccatccggaaggcggtggacaggatgagggtggccgtcagggac
ctgctggagtttgcacggggggccgtggccaactctgcccaggccactgaccgcacgctg
caggccaagctgggcaagcaggtgcagaagatggaggaagccttccagggcctggtcaag
tacagccaggctctggacgctgtgggctgggccccctctgctcaaatggcacccttagca
ggcaatggtggggatgacctggaccggctgatcatgtgtgccaggggcgtgcccgacgac
actaaacagctggcttcctttctccatggcaacgcctcgctgctctttaaaaggacaaac
aagcagcagcagcttcctcttccccacgtcccccacactgctgacctcatgggtcagatg
accaacaacaacatctcagcttatcagacaggagacggcagggccaacatccagtcccgg
ccactgccgtccccgcccaagttcacggccgaggaggagacccatgaccggccctacgag
actacagaggagggctggatggaggactatgactatgtgcatttacagggtaaggaagag
tttgagaagaatcagaggcaattattagagaaagggaccagacacaacaaaaccacactg
gaacggcagcagcagctgaaacagtttgagcgactggagcaggaagtcagccagccaatc
aacaatgacatctcaggctggaccccgcctccgcactatccagcggcccagcggagcaag
ctgagcatgggcgaccgacagctgctgctcttctactcggagcagtgtgaggctaacgtc
accaccctcaccaacgccatcgacgccttctactcctccatcaacaacaaccagccgccc
aagatatttgtggctcacagcaaatttgtcatcctcagcgcacacaagctggtgttcatc
ggggacacgctctctcggcaggccaagtccccagaggtgcgggcgcatgtggcccagcac
agtaatgctctgtgtgacaaactcaaggacattgtggtgagcaccaagactgcagcgctg
cagtatccttcccccggtgcggcgcgagacatgacggagagggtgagggagctggccggc
tgcacacagcagttccgcatggctctgggccagctggtggccatgtga

DBGET integrated database retrieval system