KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252524
Entry
112252524         CDS       T05605                                 

Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-1-like isoform X1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00760  Nicotinate and nicotinamide metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    112252524
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112252524
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112252524
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112252524
   03029 Mitochondrial biogenesis [BR:otw03029]
    112252524
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     112252524
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     112252524
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    112252524
SSDB
Motif
Pfam: SIR2 TPP_enzyme_M DUF592
Other DBs
NCBI-GeneID: 112252524
NCBI-ProteinID: XP_024279586
LinkDB
Position
1
AA seq 727 aa
MADGENILVGATSSASSMEEPISKKSKMSMAIECGLKIVQTEQATYGLEACESWAAAISA
RPDEIEPVMALGQAPAAALGGDNGLLVLEPQESVTNLNASGPAAELAECRGTDEEFHQNG
FAFPDGVNEDDDRSSHASSSDWTPQPQIGSYSFIQQHIMRETNPRTILKDLLPETVLPPD
LDDMTLWQIIINISEPPKRKKRKDINTLEDVVRLLQESKKILVLTGAGVSVSCGIPDFRS
RDGIYARLAIDFPDLPDPQAMFDIEYFRRDPRPFFKFAKEIYPGQFQPSPCHKFISMLDK
QGKLLRNYTQNIDTLEQVAGVKRIIQCHGSFATASCLVCKHKVDCEAVREDIFYQVVPHC
PRCTDIPLAIMKPDIVFFGENLPEIFHRAMRQDKDEVDLLIVIGSSLKVRPVALIPTSIP
HDVPQVLINREQLPHLNFDVELLGDCDVIVNELCHRLGGDFEQLCYNSLRLNEITENPPL
LATSAEQPSCKALSTHSKPTEKEQKHRHTDASVSASEETNTHMVSDTPERDRVPTEPCPT
AQNVTDTPEVDGVPPEPCPEGQIVQDTPELVAQPEPCPKAPSPNEERMEYSVSPSADTRS
EEGSGLNDQHINLEVRRLRWMSRICRSPISKRLETSQYLFRAPNHYIFHGAEVYSNSEDE
TSSSCESDDSSLEMEEDSDAEDEQSTPTEEVEGCLIDTVTHKNTCEGTLSVKQTDNTDTN
VQNTTDL
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggcggacggggagaatatccttgttggagccacttccagcgcttcaagtatggaagaa
cccatttcaaaaaagtccaaaatgagcatggccatagaatgtgggctcaaaattgttcag
actgagcaagctacatacgggctagaggcttgtgagagttgggctgcggcgatttctgcg
cggccagatgagattgagccggtgatggcgttaggacaggccccagcagcagcactaggc
ggagacaatgggctgctggtcttggagcctcaggaaagcgtaacaaacttaaacgcatct
ggacccgctgcggagcttgcagagtgtcgtggcactgatgaggagtttcaccaaaatggc
tttgccttcccagatggtgtcaatgaggatgatgacagatcctcacatgcaagttccagt
gactggacccctcaaccacagataggttcctacagttttattcagcaacacattatgaga
gagaccaatccgagaacaatactaaaagacttgcttcctgagactgtgcttccgcccgac
ttggatgacatgacactgtggcagatcatcatcaacatctcggagcctcctaaaagaaag
aagcgcaaagacataaacaccctggaggatgtggttcggctactccaggaaagcaaaaag
atccttgtgctgaccggcgctggggtatctgtttcttgtggaataccagactttcgatcc
agagatggcatttatgcaaggctggcaatagatttccctgatcttccagaccctcaggca
atgtttgatatcgagtacttcagaagagacccaaggccatttttcaagtttgctaaggag
atctatccaggacagttccaaccttcgccttgtcacaaattcatatctatgctggacaag
caggggaagctactacgcaactacacccagaatattgacactcttgaacaagtggctggg
gttaagaggatcatccaatgtcacgggtcttttgcaacagcttcctgtctcgtctgtaaa
cacaaggttgactgtgaggccgtaagggaagacattttttatcaggttgtccctcactgt
ccacggtgtacagatatccccctggcaatcatgaagccagatattgtcttctttggagag
aatcttccagaaatattccacagagcaatgaggcaggataaggatgaagtggacctcctt
attgtcattgggtcctcgctgaaagtgcgaccggtggctctcatcccaacctctattcct
catgacgtgcctcaagtcttgataaatcgggagcagctgcctcacctcaactttgatgtg
gagctacttggggactgtgatgtcatcgttaacgagctctgccatcggttgggcggagac
tttgagcaactgtgctacaactccttaagactcaatgagatcacagaaaaccccccgctg
ttagcgacttctgcagagcagccatcttgcaaggccttgtctactcacagtaagccaaca
gaaaaagaacagaagcaccgtcacacagatgcatcagtcagtgcttcagaggagacaaac
actcatatggtctcagacactccagaacgcgacagagtaccaacagaaccttgtccgacg
gctcagaatgtcaccgacacacctgaagtcgatggagtaccaccggagccctgtccagaa
gggcagattgtccaagacactccagaactagtagcacaaccagagccctgtccaaaggct
ccaagccccaatgaggagagaatggagtattccgtctctccatcagcagacacgcggagt
gaagaaggctctggattaaatgatcaacacatcaaccttgaggttcgcagactacgctgg
atgagtcgaatctgtcgaagtcctatcagcaagcgccttgagacttctcaataccttttc
cgagcaccaaatcactacatctttcatggggcagaagtgtactccaactcagaggatgag
acatccagctcctgcgagagtgatgactcaagcctggagatggaggaagacagcgacgca
gaggacgagcagagtacaccaacagaggaggtcgagggctgcctcatagacacagtgaca
cacaagaacacttgtgagggcacgttgagtgtgaagcagacagacaatacagacacaaat
gttcagaacaccacagacctgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252789
Entry
112252789         CDS       T05605                                 

Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-1-like
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00760  Nicotinate and nicotinamide metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    112252789
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112252789
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112252789
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112252789
   03029 Mitochondrial biogenesis [BR:otw03029]
    112252789
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     112252789
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     112252789
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    112252789
SSDB
Motif
Pfam: SIR2 TPP_enzyme_M DUF592
Other DBs
NCBI-GeneID: 112252789
NCBI-ProteinID: XP_024280161
LinkDB
Position
6
AA seq 777 aa
MFYHSTQRLYQLKMADGENILVGASSSTSTNEEPDSKKAKMSMAIECGLKIVQTKQVTYG
PEAGESLAAAISAQPKEKEIEPVMSVGQASAAAPGGDNGLLVFEPQESVVNLDKASGPTA
EPADGVNEDDDRSSHASSSDWTPQPQIGSYSFIQQHIMRETDPRTILKDLLPPETVLPPD
LDDMTLWQIIINISEPPKRKKRKDINTLEDVVRILHESKKILVLTGAGVSVSCGIPDFRS
RDGIYARLAIDFPDLPDPQAMFDIEYFRRDPRPFFKFAKEIYPGQFQPSPCHKFISMLGK
HGKLLRNYTQNIDTLEQVAGVQRIIQCHGSFATASCLICKHKVDCEAVREDIFNQVVPHC
PRCRDIPLAIMKPDIVFFGENLPELFHRAMKQDKDEVDLLIVIGSSLKVRPVALIPTSIP
HEVPQVLINREQLPHLNFDVELLGDCDVIVNELCHRLGGDFEQLCYNSLRLSEITEKPPR
SQTPCEALSTHSKPTEEEQKTRHTDSSFGASEETDTHTVTDTPEGDRVPTEPCPTAQNDT
DASEVDGVPSVPYPKTKNVSDTLGVGVPTEPCPKTQNVTGTLEVNRVATEPCPKDTLEFD
AVPLEPSPKVQIVPEAPEEPCSKTQSPNEERMENSDSPSADTQREDPSGLNDQHVNLEVR
RRCWMSRISRSPISKRLETSQYLFQAPNHYIFHGAEVYSNSEDETSSSCGSNSEDSSLEE
EDDEEEDSDAEEDQSTPAEEGEGCLIDIVTHKQACEGTSSVKQMESTDKNVQNTTDL
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgttttaccacagtacacagcggctttatcagctgaagatggcggacggggagaatatc
cttgttggagccagttccagcacttcaactaatgaagaaccagattcaaaaaaggccaaa
atgagcatggccatagaatgtggactcaaaattgttcagactaagcaagttacgtatggg
ccagaggctggtgagagtttggcggcggcgatttctgcgcagccaaaggagaaggagatc
gagccggtgatgtcggtaggacaggcctcagcagcagcaccaggcggagacaatgggctg
ctggtcttcgagcctcaggaaagtgtagtgaatttagacaaggcgtctggacccacggcg
gagcctgcagacggtgtcaatgaggatgatgaccgatcctcacatgcaagttccagtgac
tggacacctcaaccacagataggttcctacagttttatccagcaacacatcatgagagag
accgatccaagaacaatattgaaagacttgcttcctccagagactgtgcttccaccagac
ttggatgacatgacgctgtggcagatcatcatcaacatttcggagcctcctaaaagaaag
aagcggaaagacataaacaccctggaggatgtggttcggatactccatgaaagcaaaaag
atccttgtgcttactggtgctggagtgtctgtttcttgtggaataccagactttcgatcc
agagatggcatttatgcaaggcttgcaatagatttcccagatcttccagaccctcaagca
atgtttgatatagagtacttcagaagagacccaaggccctttttcaagtttgctaaggag
atctatcctggacagttccaaccttcgccctgtcacaaattcatatctatgctgggcaag
catggaaagctactacgcaactacacccaaaacattgacactcttgaacaagtggctggg
gttcagaggatcatccagtgtcatgggtcttttgcaaccgcttcctgtctcatctgtaaa
cacaaggttgactgtgaggctgtaagggaagacatttttaatcaggttgtccctcactgt
ccacggtgtcgagatattcccctggcgatcatgaagccagatattgtcttcttcggagag
aatcttccagaactattccacagagcaatgaagcaggataaggatgaagtggacctcctt
attgtcattgggtcctcactgaaagtgcgacctgtggctctcatcccaacctccattcct
catgaagtgcctcaagtcctgattaatcgggagcagctgcctcacctcaactttgacgtg
gagctacttggggactgtgacgtcatcgttaacgagctctgccatcggttgggcggagac
tttgagcaactgtgctacaactccttaagactcagtgagatcacagagaaacccccgcgg
tcacagacaccttgtgaggccttgtccactcacagtaagccaacagaagaagaacagaag
acccgtcacacagactcatcgttcggtgcctcagaggagacggacactcatacggtcaca
gacactccagaaggcgacagagtaccaacagaaccttgtccgactgcgcagaatgacaca
gacgcatctgaagttgatggagtaccatcggtgccctatccaaagacaaagaatgtctct
gacacgcttggagttggagtaccaacagaaccctgtccaaagactcagaatgtcacaggc
accctggaagtcaacagagtagcgacagagccctgtccgaaagacactcttgaattcgat
gcagtgccattagagcctagtccaaaagtgcagattgtcccagaggctccagaagagcct
tgttcaaagactcagtcccccaatgaggagagaatggagaattcagattctccgtcagcg
gacacgcaaagggaagacccctctggattaaatgaccaacatgtcaaccttgaagttcgc
cgacgatgctggatgagtcgaatcagtcgaagtcctatcagcaagcgccttgagacttct
caatacctattccaagcaccaaatcactacatcttccacggggcagaagtgtattccaac
tcggaggacgagacatccagctcctgcgggagcaacagtgaggactccagcctggaggag
gaggacgacgaggaagaagacagcgatgccgaggaggaccagagcacaccagcagaggag
ggcgagggctgcctcattgacatagtgacacacaagcaagcctgcgagggcacttcgagt
gtgaagcagatggagagtacagacaaaaatgtccagaacaccacagacctttag

DBGET integrated database retrieval system