KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252657
Entry
112252657         CDS       T05605                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252657 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112252657 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112252657 (kitlg)
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112252657 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 112252657
NCBI-ProteinID: XP_024279863
LinkDB
Position
6
AA seq 257 aa
MKKSKIWIRICVHLLVCTTFGVHSSEFGDAVTDDITSISLLKQNIPKDYKIPVTYIPKEV
GGMCWVTLNVFHLELSLRGLADKFGNISSNKYNISILIEMLKETRYHMKNLEVITSDFEC
HYRDEKWQTGHYFQFVEDFLNTARSNRDLPEECDPPPCPTTTKASATTITTQYPASGKEP
LRFLPEVVERSLLSLLVIPIAAIIFLFVWKVKSRSNQHQSDELKSVEGGHFTGTEESLAP
PLDDISEKNRLNIIEAV
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaatttggatacgcatctgtgtccatttattggtgtgcaccacattt
ggagttcactcaagtgaatttggagatgctgtaacagatgacatcacaagcatttcacta
ttgaaacaaaatatacctaaagattacaagattccagtgacatatattccaaaagaagtg
ggtggaatgtgttgggtcacgctaaatgttttccacttggaactcagtttacgaggatta
gcagacaagtttggaaacatttcatccaacaaatataatatcagcatattgatcgaaatg
ctgaaagagacgcgatatcacatgaagaacttggaggtgatcacatctgattttgagtgc
cactatagagatgagaaatggcagacaggacactattttcagtttgttgaagattttcta
aacacggcccgttcgaatagagatttgccagaagaatgcgatccacctccctgtccaaca
acaacaaaggcatcagcaactacaataacaacacaataccccgcatcagggaaagagcct
ctgaggttcctgccagaagtagtggagagaagcctcctgtcactacttgtaattcctatt
gcggccatcatatttctgtttgtgtggaaggtgaaatccaggagcaaccaacatcaatca
gatgaactgaaatcagtggaaggaggccacttcacaggaacagaagagagtttggcacct
ccactagatgacatttctgaaaagaacagattgaacatcattgaggcagtgtaa

DBGET integrated database retrieval system