KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252678
Entry
112252678         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112252678
   04340 Hedgehog signaling pathway
    112252678
   04371 Apelin signaling pathway
    112252678
   04068 FoxO signaling pathway
    112252678
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112252678
   04115 p53 signaling pathway
    112252678
   04218 Cellular senescence
    112252678
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252678
   04530 Tight junction
    112252678
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112252678
NCBI-ProteinID: XP_024279896
LinkDB
Position
6
AA seq 292 aa
MEHLLLCCEVETIRRAYQDSNLLNDRVLQTMLKAEDNYLPATNYFKCVQKEIVPCMRRIV
ATWMLEVCEEQKCEEEVFPLAMNFLDRYLSVEPTKKTRLQLLGATCMFLASKMKETIPLT
AVKLCIYTDNSIRTGELLQMELLVLNKLKWDLASVTPHDFIDHFLSKLPIHQDTKQILCK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLNLKSMDDALSSQQLTDFLSQVIRSD
PDCLRACQEQIESLLETSLRQAQQHTVSIDTKSMDEEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacacctgttgctgtgctgtgaagtggagaccatccggagagcttaccaagactcg
aacctgctcaacgacagagttctgcagaccatgctaaaagcggaagacaattatctcccc
gcaacgaactacttcaaatgtgtacagaaagagattgtaccctgcatgaggagaattgtt
gctacgtggatgctggaggtctgtgaggaacagaaatgcgaagaggaggtttttccccta
gctatgaattttttagacagatatttgtctgttgaacccacaaagaagactcgactacag
ttattgggcgctacatgcatgtttctggcgtctaaaatgaaggagaccattcctctaaca
gctgtgaagttgtgcatatacacagacaattccatccggacgggcgagttgctgcaaatg
gaactactggtattgaacaagctgaaatgggatctagcatcagttactccgcacgatttc
atagaccacttcctctccaagctacccatccatcaggacaccaagcaaatcctgtgcaag
catgcccagacctttgtggctctctgtgctacagatgtcaaattcattgccaaccctccg
tcaatgatcgcagcaggcagtgtggcggctgctgtccaggggctgaatctgaagagcatg
gacgatgcactgtcatcccagcaactcactgacttcctgtctcaagtcatcagaagtgac
ccggattgtctacgggcatgtcaagaacagatcgagtccttattggagaccagtctccgt
caggcacaacaacacactgtttccattgacaccaagagcatggatgaggaggttgacctg
tcgtgcacgccaacggacgttagagatgtgaacatctga

DBGET integrated database retrieval system