KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253054
Entry
112253054         CDS       T05605                                 

Gene name
bnip3
Definition
(RefSeq) BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
  KO
K15464  BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112253054 (bnip3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112253054 (bnip3)
   04137 Mitophagy - animal
    112253054 (bnip3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112253054 (bnip3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:otw02000]
    112253054 (bnip3)
Membrane trafficking [BR:otw04131]
 Autophagy
  Mitophagy
   Cargo receptors
    112253054 (bnip3)
Transporters [BR:otw02000]
 Other transporters
  Pores ion channels [TC:1]
   112253054 (bnip3)
SSDB
Motif
Pfam: BNIP3 TBX
Other DBs
NCBI-GeneID: 112253054
NCBI-ProteinID: XP_024280692
LinkDB
Position
6
AA seq 187 aa
MSLQKEIPYEESLQGSWVELHYNTGSGSQVCQEQISTTALDVDLEKLLLDAQHESSRSTS
RGSSQCDSPLRSQTPLLLFRGSEGNSSQSEEDNQERIQEVENLLKKNADWIWDWSSRPEN
NPPKEFLLKHPRRSASLSIRKTNVMKKGGVLSPDFLKLFLPSLFISHILAVGLGIYIGRR
LSTYSTY
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtcgcttcagaaggaaattccgtatgaggagagcttgcagggttcctgggtggaattg
cactataacactggcagtgggagtcaggtgtgccaggagcagatctcaacaactgctctt
gatgtagacctggagaagttactactagacgcccaacacgagtcaagcaggagtacctcg
agaggaagctcacaatgtgacagtccacttaggtcacagactcctcttcttctgtttaga
ggctcagagggaaacagttcacagtctgaggaagataaccaagaaagaatccaggaagta
gagaatctactgaagaagaatgctgactggatctgggactggtccagtcgtcctgagaac
aacccaccaaaggagtttctgctgaaacaccccaggcgctcagcctcgctcagcatcagg
aagaccaacgtcatgaagaaaggaggagttctctcccctgacttcctcaagcttttccta
ccttcattattcatttctcatatactcgcagttggcctggggatatacattgggaggcgc
ctcagcacatacagcacctactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257438
Entry
112257438         CDS       T05605                                 

Definition
(RefSeq) BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
  KO
K15464  BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112257438
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112257438
   04137 Mitophagy - animal
    112257438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112257438
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:otw02000]
    112257438
Membrane trafficking [BR:otw04131]
 Autophagy
  Mitophagy
   Cargo receptors
    112257438
Transporters [BR:otw02000]
 Other transporters
  Pores ion channels [TC:1]
   112257438
SSDB
Motif
Pfam: BNIP3
Other DBs
NCBI-GeneID: 112257438
NCBI-ProteinID: XP_024286758
LinkDB
Position
9
AA seq 184 aa
MSLSGSQTPEDGLYDTWVELEELLSAVSSRESLTGQEQDTASWALQGELQRILLEAQLES
KDSPPQVVTPPQTVVSPPHSEGSSSTDCVTIQSEEEGERGLISEWVWDWSSRPENLPPKE
FVFQHPKQQSGSLSVRKSEVMKRGLFSSDVLMILIPSLLVSHLLTLGVGIYIGKRLAAST
TSTL
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtctctgtcaggttcgcagactccagaggacggcttgtacgacacttgggtggagctg
gaggagctgctatcagcggtgagcagcagggagagtctgacaggacaagaacaggacaca
gcctcctgggccctgcagggggagctacagaggatcctgctagaggcacagctcgagagt
aaagacagtcctccacaggtggttactcctccacagactgttgtttcccctccccacagt
gaaggcagcagcagtacagactgtgttaccatacagtccgaagaagaaggggagaggggg
ctgatttctgagtgggtatgggactggtccagtcggcctgagaaccttccaccaaaggag
tttgtgttccagcacccgaagcagcagtcaggctccctgagtgtaaggaagagtgaggtg
atgaagagaggcctgttctcctccgacgtcctcatgatcctcatcccctcactgctggtc
tcacaccttctcacactgggagtggggatatacatagggaagcgattggctgcctccaca
actagcactctgtga

DBGET integrated database retrieval system