KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253141
Entry
112253141         CDS       T05605                                 

Gene name
bcl2l11
Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112253141 (bcl2l11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112253141 (bcl2l11)
SSDB
Motif
Pfam: Bclx_interact
Other DBs
NCBI-GeneID: 112253141
NCBI-ProteinID: XP_024280870
LinkDB
Position
6
AA seq 211 aa
MNHKIGPNGTTTLIERGKSGESHPGGGAASRAEPSDNPQSCEGDQQSLGGIMIPNSLLGF
QSRSPVFRTLSRSSSGYFSFDSDSIPSSPLLKDNKSTQTPSPSSQVITHALQRMSRALET
RRDYDVWPNPLRPYRASPPPTAADMRPEILIGQELQRIGDEFNNLFIHGRLAGRNGQVAQ
GNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaaccacaaaatcggtccaaatggcacaaccaccctaattgagagagggaaaagcgga
gagtcgcatcccggtggcggagcagcctcccgtgccgaaccgtctgacaacccccagtcc
tgcgaaggggaccagcagtcactgggaggaataatgattccgaatagtctgcttggtttc
cagtcgaggtcgccggtgttcagaacactgtccaggtcctccagtggatatttttcgttc
gacagcgattctattccaagctccccgctattgaaagataacaagtcgacacagactccg
agcccatctagccaagtcattacccacgcactgcagcgcatgtctcgagcactggagacc
cggcgagattatgacgtgtggcccaaccccctccggccctatagagcaagcccgccaccg
actgcggcggacatgcggccagagatactcatcggtcaggagcttcagcgcattggagat
gagtttaacaacctcttcatacatgggcgccttgcaggcagaaacggtcaggttgcccag
ggaaacctgcagcagatgcaccaagagcccgccttcctactgtggatgggtcttctgatt
ggacgactattacagataatcctgcggagaagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255614
Entry
112255614         CDS       T05605                                 

Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112255614
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112255614
SSDB
Motif
Pfam: Bclx_interact
Other DBs
NCBI-GeneID: 112255614
NCBI-ProteinID: XP_024284295
LinkDB
Position
1
AA seq 229 aa
MTLHRQNNKNSLTLILDLSYRRQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFS
EGEQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFDSDSIPSSPLLKDKSTQTPSP
SSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPPTAGDMWPETLIGQELQRIGDEF
NDLFIHGRLAGRNGHVAQANLQEMHQEPAFLLWMGLLIGRLLQIILQRR
NT seq 690 nt   +upstreamnt  +downstreamnt
atgacattgcaccgacaaaataataaaaacagcctaactctgatacttgatctatcctac
agacgacaaaatcagtccaatggctcgaccatcctaattgagagagggaaatacggagaa
ttgaatcccggtggcggagcagcctccggtgccgaaccgactgacaatccccagttcagc
gaaggggagcagcagtcacggggaggaataatgatgccgaatagtctgcttggtttccag
tcgaggtcgccgttgttcagaacactgtccaggtcatccagtggatatttttcgttcgac
agcgattctattccaagctccccgctattgaaagataaatcgacacagactccgagccca
tctagccaagtcatgactcacgcactgcagcgcatgtctcaagcacaggagaccaatcga
gattatgacgcgtggcccaaccccctccacccctatagaccacggccaccgccaactgca
ggggacatgtggccagagacactgattggccaggagcttcagcgcattggtgatgagttt
aacgatctcttcatacatgggcgccttgctggcagaaacggtcatgttgcccaggcaaac
ctgcaggagatgcaccaagagcccgccttcctactgtggatggggctcctgattggacga
ctattacagatcatcctgcagagaagatga

DBGET integrated database retrieval system