KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254134
Entry
112254134         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase 4-like isoform X1
  KO
K04411  serine/threonine kinase 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112254134
   04068 FoxO signaling pathway
    112254134
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112254134
Protein kinases [BR:otw01001]
 Serine/threonine kinases: STE group
  STE20 family
   112254134
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Hamartin Haspin_kinase
Other DBs
NCBI-GeneID: 112254134
NCBI-ProteinID: XP_024282170
LinkDB
Position
7
AA seq 492 aa
MENKDKVQMRTHPRRQLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKANYKETGEIVA
IKQVPVESDLQEIIKEISIMQQCNSPHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRLR
NKTLTEDEIATIVQSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQLTDT
MAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIP
TNPPPTFRNPDLWSELFQEFVSQCLVKNPENRATATQLLQHPFIKAAKPSSILRALITDA
MEIKLKKVEAEQREQDQEDEDNSDEDEVDQGTMVRAGTSDMGTIREAGSLGGTARTMIEQ
SDMDTMESQLGTMVINSDDDEDEEAGTMKRRDETMQPAKPSFLEYFEQKEKEANCHDDSG
EDPGHNADNRKLPAEGDLEVMRTWSVEELRSRLASLDPQMEQEIREIRQRYLAKRQPILD
AIEAKKRRQQNL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggagaacaaggacaaagtacaaatgaggacacacccacgcaggcagctaaagaagctc
agtgaagacagtttaaccaagcagccagaggaagtttttgatgtgctagagaaacttggc
gaagggtcctatggcagtgtatttaaggccaactataaagagactggggagattgtggcc
atcaagcaggtccctgtggagtctgacctgcaggagatcatcaaagagatctccatcatg
cagcagtgtaacagtccccatgttgtgaggtactacggaagttactttaagaacagtgac
ctgtggatcgtaatggagtactgcggagctggctctgtctccgacatcattcgcctgcgc
aacaaaacgctaacagaggatgagatcgccaccatagtgcagtccacattgaagggactg
gagtacctgcactttatgaggaagatccacagagacatcaaggcagggaatatcctgcta
aacgcagagggccaggccaagctggctgactttggggtggcgggacagctgaccgatacc
atggccaagcggaacacagtgattggcactccattctggatggcccctgaggtgatccag
gagattggttataactgtgtggcagacatttggtccctgggcatcacagccatagaaatg
gcagagggaaagcctccctatgcagacatccaccctatgagggccatatttatgattcct
accaatcctccaccgacgttccgaaacccagacttgtggtcggagctgttccaagaattt
gtctcccagtgtctggtgaagaacccagagaacagagccactgccacacagcttctacag
catccattcattaaggctgctaagcccagcagcatcctcagagctttgatcacagatgcc
atggaaattaaactgaagaaagtggaggccgagcagagagaacaggaccaagaggacgaa
gacaactcggacgaggacgaggtagaccagggaacgatggtgagggcgggcactagcgac
atgggcaccatccgggaggccggttcgctagggggcacggcgaggaccatgatcgagcag
agcgacatggacaccatggagtctcagctgggcaccatggtgatcaactcagacgatgac
gaggacgaggaggccggcaccatgaaacggagagatgagaccatgcagcccgccaagccg
tccttcctggagtactttgagcagaaagagaaggaggccaactgtcatgacgatagtgga
gaagatccaggacacaacgctgacaaccgcaaactgcctgcggagggggacctagaggtg
atgcgaacatggagcgtggaggagctgaggtcacggctggcctccctggacccccagatg
gagcaggaaatcagggagatccgccagcgctacctggccaagcgccagcccatcctggat
gccatcgaggccaagaagcgacgccagcagaacctctga

DBGET integrated database retrieval system