KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254295
Entry
112254295         CDS       T05605                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 112254295
NCBI-ProteinID: XP_024282465
LinkDB
Position
7
AA seq 373 aa
MSWGEFIELRELRLHDPIELTSCEVPRSPPRLERANALRISPGKVPELLSRVGIIRLLGD
SLDLLLTDERGEGHDFQPCSHAQPTWCDLCGGFIWGLYKQSLRCANCRFTCHYRCRAVIQ
LDCSLDGSSIVEQTCVMEHTMETDTDVDEQVEWGKQQDLSVTEIQQKVKEYNAQINSNLF
MNLNKDGSYTGFIKVQFKLLRPVSVPPPRKGTATQVGAGKKTGGVKRRSSFYLPKDTSKH
LHISSRTCAREVIEALLKKFTVVDNPGKFALFESTKRHDQVFLRKLSDDERPLHLRLCAG
PNDKALSLVLKENETGEVNWDAFSMPELKNFVRMLQREEEEHVKQIVQRYALARTRMQEA
QAASPTPGGSTPG
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtcttggggtgagttcattgagctccgtgagctgaggctccatgacccgatagagctg
accagctgcgaggtgcctcgctcaccacctcgcctggagcgggccaatgctctgcggatc
agcccagggaaggtcccagagctgctcagccgggtgggcatcatcagactgctgggggat
agcctggacttactgctcacagatgagaggggagagggacatgacttccaaccctgcagc
catgcccagcccacctggtgtgacctgtgtggaggcttcatctggggactgtacaaacag
agcctacgctgtgccaattgcagattcacatgtcactacagatgtcgagctgttatccaa
ttagattgcagtttggatggtagctccatagttgaacaaacatgtgttatggaacacacc
atggagaccgatacagatgtggatgaacaggttgaatgggggaagcagcaggatctgtca
gtcacagagatccagcagaaggtgaaggagtacaatgctcaaatcaacagcaacttgttc
atgaacctgaacaaagatggctcctacactggcttcataaaggtccagttcaagctgcta
cgacccgtgtcagttcccccaccaagaaagggtactgcaacacaggttggtgcgggcaag
aagactggtggagttaagcgtcgctcctctttttacctgcccaaggatacgtccaaacac
ctacatatcagctcccgcacatgtgctcgtgaggtcatcgaagccttgttgaagaagttc
accgtggtggacaaccctggaaagtttgctttgtttgagagcacaaagcgccatgaccaa
gtattcctgcgcaagctgtctgacgacgagcgtccactccacctgcgtctgtgtgctgga
cccaatgacaaagccctcagtttggtgttaaaagagaatgagactggagaggtcaactgg
gatgccttttctatgccagagctcaagaactttgttcgcatgttacaacgtgaggaggag
gagcatgtcaagcagatagtgcagcgctacgcactagcccgcaccaggatgcaggaggcc
caagctgctagtcccacccctggtggttccacccctggctga

DBGET integrated database retrieval system