KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254533Help
Entry
112254533         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04218  Cellular senescence
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112254533
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112254533
   04070 Phosphatidylinositol signaling system
    112254533
   04150 mTOR signaling pathway
    112254533
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112254533
  09143 Cell growth and death
   04115 p53 signaling pathway
    112254533
   04218 Cellular senescence
    112254533
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254533
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112254533
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112254533
    3.1.3.48  protein-tyrosine-phosphatase
     112254533
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     112254533
Protein phosphatases and associated proteins [BR:otw01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    112254533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 112254533
NCBI-ProteinID: XP_024282977
LinkDB All DBs
Position
1
AA seq 446 aa AA seqDB search
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKSHYKIYNLCVERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRSKFQEPQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNKLDYKPVALLFHKMVFETLPMFSGGTCRDSTIKNRSEPIPLGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKHMLFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPSEESIEKVENGSVVVVVNDMEGVQNQPPGGPHAQPPQSTKRRDSGKDSDGDYLI
LALTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEDSLNSEVSTSTSVTPDVSDNEPDHY
RYSDTTDSDPENEPFDEEQHTQITKV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgataataaaagaaatggtcagccggaacaaaaggagataccaggaggatggg
ttcgacttggacttaacgtatatctatccaaacatcattgctatgggctttcctgcagaa
cgactcgaaggagtgtacagaaacaatatagacgacgttgtgcggtttcttgactcaaaa
cataaaagccattataagatttacaatctttgtgtagaacgacactatgatgctgccaaa
tttaactgcagagttgcacagtacccctttgaagaccacaatccgcctcagctagagctc
atcaagccattctgtgaagatctggaccagtggctgagcgaggatgacaatcatgtggcg
gccatccactgcaaggcagggaagggccgcactggggtgatgatctgcgcctacctcctg
caccgcagcaagttccaagagccccaggaggccctcgacttctatggggaagtgcggaca
agggacaagaagggagtgacaatcccgagccaacggcgctatgtgtactactacagccac
ctgctgaagaacaagctggactacaagccagtggctctgctcttccataaaatggttttt
gagacgctgccaatgttcagcggaggcacctgcagggacagtaccattaaaaacaggagc
gagccgatccctctgggcttcaagaaagggaattggcattgggatcctcagtttgtggtg
tatcaacttaaagtcaagatccacacatccaacccggctcacacacggagggaagaaaag
cacatgctatttgagtttccccaaccgctgcccgtgtgtggagacatcaaagtggagttc
tttcacaagcaaaacaaaatgatgaagaaggataagatgttccacttctgggttaacacc
ttcttcattcccgggccatcggaggagagcatagagaaggtggagaacgggtcggtggtg
gtggtggtgaacgacatggaaggggtccagaaccagcccccgggcggcccccatgcccag
cccccccagagcaccaagcgcagggacagcggcaaagacagtgacggggactacctcatc
ctcgcgctgaccaagaatgacctggacaaggccaacaaagacaaagctaaccgctacttc
tcacctaatttcaaggtgaagttgtatttcacaaaaaccgtggaagattctttgaattcc
gaggtgagcacttcgacatccgtcactccggacgttagcgacaatgagcctgaccattat
cgatattccgacaccactgactctgatccggaaaatgaaccttttgacgaggaacagcac
acgcaaatcacaaaagtgtga

DBGET integrated database retrieval system