KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254565
Entry
112254565         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1C-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112254565
   04068 FoxO signaling pathway
    112254565
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112254565
   04115 p53 signaling pathway
    112254565
   04218 Cellular senescence
    112254565
SSDB
Motif
Pfam: CDI PMSI1 DUF2576
Other DBs
NCBI-GeneID: 112254565
NCBI-ProteinID: XP_024283028
LinkDB
Position
7
AA seq 153 aa
MCRSRTTMASSKWILSSLGKGPARRNLFGPVDHEQLQQEYQNALRRDLEDACHRWGFDFL
SEKPLAGGDFQWEGVLSTKLPLLYQPCLLGQREGGLVAITGRVRAGPLHRGKENIPCTPE
KCVANHQNLEKTPDKKENTNHNENRLTTKQTED
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtgtagaagcagaacaaccatggccagttctaagtggattctgagctccctggggaaa
ggtcctgccagacggaacctgtttggcccagtggaccatgagcagctgcagcaggagtac
cagaatgccttgcgcagagacctggaggacgcctgccaccgctggggctttgatttcctg
tcagagaagcctctggctgggggagacttccagtgggagggggttctaagcaccaagctg
cctctcctctaccaaccctgccttttgggtcagagggagggaggcctggtggccatcaca
gggagggtcagggcagggccattgcaccgtggcaaggagaatatcccttgcacccctgag
aagtgcgtagccaaccaccagaatctggagaaaacaccagacaagaaggagaacacgaac
cacaatgaaaacagactgacgacgaaacagaccgaagactaa

DBGET integrated database retrieval system