KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254807
Entry
112254807         CDS       T05605                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112254807
   04012 ErbB signaling pathway
    112254807
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 112254807
NCBI-ProteinID: XP_024283451
LinkDB
Position
7
AA seq 196 aa
MMNRAFWDAIFLITGSLFTYGTGQDNSTIATNSTITTTPPVTTTTTTVNVTTSSTTTTSI
TTTTTIPVKKFVAAAVRSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHQGFVGMRCEH
ADLLAVVATNHRQQTVATVLVLCVIGCVLTMLLCTLLHCWWRRDGLGRRHRLHCAPEKQG
SMLKGRGSCCHSESVV
NT seq 591 nt   +upstreamnt  +downstreamnt
atgatgaatcgggctttctgggatgcgatatttctcattactggttccctctttacatat
ggaacaggccaggataattccactattgctactaattctacaattaccaccacacctcct
gtaactaccaccactaccactgtaaatgttactacctcttctactaccaccaccagtatc
accactacaaccaccattccagtgaaaaagtttgttgcagcagctgttcgatcccacttc
gatgactgtcctgactcccacagccacttctgtttccatggcacctgtcgtttcttgatt
ctggaggagacacccgcatgtgtgtgtcaccaaggctttgtagggatgcgatgtgagcac
gctgacctgctagctgtggtggccaccaatcacaggcaacagacagttgccacggtgcta
gttctgtgtgtgattggttgcgtcttgacgatgctgctctgcacccttttacattgctgg
tggaggcgggacggtttggggcggaggcacagactccactgtgccccagagaaacaaggc
agtatgctgaagggcagagggtcatgctgtcactctgaaagtgtggtgtaa

DBGET integrated database retrieval system