KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254921
Entry
112254921         CDS       T05605                                 

Definition
(RefSeq) uncharacterized protein LOC112254921 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
SSDB
Other DBs
NCBI-GeneID: 112254921
NCBI-ProteinID: XP_024283655
LinkDB
Position
7
AA seq 146 aa
MLTMGSESPQAIARLFAWVNGISKCELIELKDLSLNDRTELAPEPPAAPPPAAPLTPRQN
RDGSYTGFIRVLFKLTRPVSLPPPWKASSPQESGQLDGGMKCRTSFYLPKDTAKHLHIGS
RTQVREVIEALNVKTRIRASYCLLLD
NT seq 441 nt   +upstreamnt  +downstreamnt
atgctaaccatgggcagtgagtctccacaggccattgcccggctttttgcctgggtcaac
gggatctccaagtgtgagctgattgagctgaaagatctcagcctaaatgatcgcactgag
ctggcaccggaaccaccagccgctccgcccccagcagcacccctgactcccaggcagaac
cgagacggatcatacactggcttcatcagggtcctttttaagctgactcgtcccgtgtca
ctcccacccccttggaaggcgtcttcaccacaggaatcggggcagctggatgggggaatg
aagtgccggacctctttctaccttcccaaagatacagccaaacacctgcacataggctcc
cggacacaggtacgagaggtcatagaggccctgaacgtcaaaaccagaattcgagctagc
tactgtcttctacttgattaa

DBGET integrated database retrieval system