KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254937Help
Entry
112254937         CDS       T05605                                 

Definition
(RefSeq) neuroendocrine convertase 1-like
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:otw01002]
    112254937
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:otw03110]
    112254937
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     112254937
Peptidases [BR:otw01002]
 Serine Peptidases
  Family S8: subtilisin family
   112254937
Chaperones and folding catalysts [BR:otw03110]
 Intramolecular chaperones
  Subtilisin family
   112254937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 112254937
NCBI-ProteinID: XP_024283696
LinkDB All DBs
Position
7
AA seq 779 aa AA seqDB search
MEMRCRPTTVLCCALAVLCSVARSVNASFGDRQYLNEWAVEIPGGLDAARSIAKELDYRV
VRQIGALENHYLFKHQTHPSRTKRSADHITKRLSEDDRVSWAEQQYEKRRSKRASLGSCR
DCPVDELFNDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWKKGFTGKGVVITVLDDGLEWN
HTDIYPNYDTAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNS
KVGGIRMLDGIVTDAIEASSIGFNSDHVDIYSASWGPNDDGKTVEGPGRLASKAFEYGIQ
KGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPELTWRDLQHLVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPDTWKHVPEKKQCIIRDDS
FQPRALKAAGEITIEIPTKACNGQDNAVLSLEHVQVEASIEYTRRGDLHITLTSPSGTST
VLLAERERDMSSNGFRNWDFMSVHTWGEDPTGTWTLKITDTSGRMENEGQILTWKLILHG
TSEKPEHMKKPRVYVPYNAVQNDRRGVEHMDDMMEELSTQAEAHSLQKTQPPPSATPKMK
QMRPSSPPLSPSLALLRLLQMAFNRQTPAALHQSPEKAPSSRGEQHQGRSYSIPGGAGPR
IAPQKLYQALDRINQYQRAGQDESLYSDYSDGFYSAKPYRHRDDRLLQALFNMLSNDRQ
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgagatgtcgcccaacaacggtgttgtgctgtgctcttgcggttctctgctcc
gtcgctcgttccgtaaatgcttcattcggggacagacagtacctcaacgaatgggcggtg
gagattcccggaggactggacgccgccaggtccattgccaaagaactggactaccgagta
gtccgccagattggggcgctagaaaaccattacttgttcaaacaccagactcatcccagc
aggacgaaacgaagtgccgatcacatcaccaaacgcctgtccgaggatgatcgggtatca
tgggcggagcaacaatatgagaagcggcgcagtaagcgggcgtcactggggtcatgccgg
gactgtccggtggacgagctgttcaatgaccctatgtggaaccagcagtggtacctgcaa
gacactcggacgtcgtcctccctgcccaagctggacctccacgtgattcctgtgtggaag
aaagggttcacaggaaaaggagtggtcatcaccgtgctggacgacggtctggagtggaac
cacaccgacatctaccccaactatgacacagcagccagctacgatttcaatgacaatgac
cctgaccccttccccaggtacgactccaccaatgagaacaagcatgggaccaggtgtgcc
ggtgagatcgccatgcaggcagacaacaataaatgtggagtcggggtggcgtacaactcc
aaggttggagggatccgcatgttggatggtatcgtgacggatgccatcgaggccagttct
attggcttcaattcggaccacgtggacatctacagtgccagctggggacccaacgatgat
ggaaaaacggtggagggtcccggtcgcctggcgtcaaaagcctttgagtacggcatccag
aagggccggggagggaagggctctatcttcgtgtgggcatcaggaaacgggggccgccag
ggggacaactgcgactgcgacggctacacagacagcatctacaccatctccatcagcagt
gcctcccagcagggcctgtccccctggtatgctgagaagtgctcctccaccctggctacc
gcctacagcagcggagactacaccgaccagagaataaccagtgctgatttgcataatgaa
tgcacagagacacacacaggaacctccgcctccgccccactagctgctgggatatttgcc
ctcgcactggaacagaaccctgagctgacgtggagggatctgcagcacttggtggtgtgg
acgtctgagttcgacccgctggccaacaaccccggctggaagaggaacggggcaggcctg
atggtcaacagtcgttttggcttcggcctgctcaatgccaaggccctggtggacctggcc
gacccggacacctggaaacacgtccctgagaagaaacagtgcataatcagggatgactcc
ttccagcccagggcattgaaagcagcaggagagatcaccattgagatccccaccaaggcc
tgtaatggccaggacaatgctgtcctctcactggagcatgtgcaagtggaggccagcatc
gagtacaccaggagaggagacctacacatcacactcacatccccatcaggcactagcacg
gtcctgctggcagagagagagagggacatgtcatctaacggcttcaggaactgggacttc
atgtctgttcacacctggggagaagaccccactggcacctggaccctcaagataactgac
acgtccgggcggatggagaatgaaggccagatcctgacctggaagttgattctccacggc
acgtcagagaagcccgagcacatgaagaaacccagagtgtatgtcccttacaatgctgtc
cagaatgaccgtagaggagtagagcacatggacgacatgatggaggaactgtccacccag
gctgaggcccactcactgcagaagactcaaccccctccttctgccacccccaagatgaag
cagatgaggccctcctccccacccctgtcaccctccctggccctcctgcgtctcctccag
atggccttcaaccggcagacccccgccgccctgcaccagtccccagaaaaggccccctct
agcaggggagagcagcaccagggcaggtcatactccattccagggggagcaggccctcgc
atcgctccccagaagctgtaccaggccctggacaggatcaaccagtaccagcgggccggg
caggatgaaagcctttacagcgactacagtgacggcttctacagcgccaagccctacagg
cacagagatgaccggctgctgcaggcactcttcaacatgctctctaacgacaggcagtga

DBGET integrated database retrieval system