KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256330
Entry
112256330         CDS       T05605                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112256330 (egf)
   04012 ErbB signaling pathway
    112256330 (egf)
   04068 FoxO signaling pathway
    112256330 (egf)
   04020 Calcium signaling pathway
    112256330 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112256330 (egf)
   04540 Gap junction
    112256330 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112256330 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112256330 (egf)
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112256330 (egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA cEGF EGF EGF_3 DUF5050 EGF_MSP1_1 Plasmod_Pvs28 hEGF
Other DBs
NCBI-GeneID: 112256330
NCBI-ProteinID: XP_024285270
LinkDB
Position
8
AA seq 1048 aa
MDLDGGNQKRVVTGVGNSILLDFHYTEGRVYWADKKTGVIYKAAMDGTQRQKLHSSEKGI
SGLAVDWVHNFVIWTSGEVGSIKRVDTDGKNERTLLRHLSQPISIAVAPNDRFIFWLSDG
ITPSIQRSDVAGEMITTVLKIPERLGGLSVDRMDKRLFWVQFSLEGESAIGSCDYNGNVV
NVIDQPLLSQSLGMSVFLEQVFYTDMSSRTIRQVNKYSGVEAENINLKRMTHPPTAVKVV
HPLNQPIEDSMPVFPVCDGRTGVCVNVCSNPADQGICQCTKGFALSKHGNYCEDVNECGL
WDHGCSLGCENIPGSYFCTCPKGYALLPDRKTCHETSPCLANMTQCDNGCIATGEGTICV
CLEGSLLQPDGQTCRGCTSSDRGGCSQQCSPITPGRWECDCLPGYKLHQDGKRCTATGPP
PYLLFANIVNIRRVNLDGTGDQSLVEEPSGTVIALDYDPVQNKVYFASTVLKQIERADLD
GGSREVLLTEELDSPEGLAVDWVNRKLYWTDRGLSTIDRSTLDGFDRETIISKGIQKPRG
IAVHPLAKKLFWTDMGTRPVLESASLEGSDRAVIASADLVSPSGLTIDFTEDRLYWCDSK
RGVLETASLDGSNRQVLTENEVGQPFDLAVFEDRLWITDREQQLLLSVDKWTGMDPERLH
GNMVQPASIVVVHPLAKPGANVCLYRNGGCAQVCESRLGFAHCSCHSHIAQSADGKGCLP
SYRSTGDMNSNSGDGESADPFSLKNKTLNDESMPLPPTLFIETMVSDQDDCFSLRCDVNA
QCLLDGGNPTCHCLEGFTGDGELCLDLDECMLGMALCSIQSSVCVNTAGGYYCQCRPGFS
GEEHHCTDFDECKMGTHKCDERAECINTIGKYRCKCQAGYSGNGHTCQELSTTSSWVTTS
RPMDVTSQWLNTNTVESCPSSHDTYCLYEGVCLYFPEMESYACNCISGYMGERCQFSDLE
WWELQQAEQEKRRNVAIALGMVVLITLLSIAACVTYCYGSRRFVRKHPSVDDMSETSTSD
DTMSETTVPKTPRVSLNPVNGDFRTEKQ
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggaccttgatggagggaatcaaaaaagggttgtgaccggtgttggaaactctatccta
ctggacttccactacacagaggggagagtttactgggccgataaaaagacaggggtcatc
tacaaagcagcgatggatggaacacagagacagaagctgcactcgtctgagaaagggatc
tcaggccttgcggtcgactgggttcacaattttgtcatttggaccagtggagaagtggga
agtatcaaaagagtggatacagatgggaaaaatgagaggactcttctaagacatttatcg
cagccaatctccatagcagttgcaccaaatgacagatttatattctggctgtctgatgga
atcacacccagtattcagaggtcggatgtagcgggagagatgattactacagtgctgaag
attccggagagactgggagggctgtcggtcgaccggatggacaagagactgttctgggtc
cagttcagtctggaaggagaaagtgccattgggtcgtgtgactacaacgggaatgttgtc
aatgtcattgaccagccactactgtctcagtctttggggatgtctgtgttcctggagcaa
gtcttctacactgatatgagttcacggaccatacggcaagtcaataagtactcaggggtt
gaggcagaaaacatcaacctaaagcgaatgacacacccccctactgctgtcaaggtggta
catcccctcaaccagccaattgaagactccatgcctgtctttccagtgtgtgatggtcgt
acaggagtgtgtgtgaatgtgtgctccaacccagctgaccaggggatctgccagtgcact
aaaggctttgcccttagcaaacatgggaactactgtgaagatgtcaatgagtgtggcctg
tgggaccacggctgttccctgggctgtgagaacattccaggctcctacttctgcacctgc
cccaagggttacgctctgcttcctgataggaaaacctgccacgagacctcaccatgtctg
gccaatatgacccagtgcgataatggatgtattgctactggtgaggggaccatctgtgtg
tgtctagaggggtccctactacagccggatggacagacctgcagaggctgcacctcttcc
gaccgagggggctgtagtcagcaatgttcccccatcactcctggtaggtgggagtgtgac
tgtctgcctgggtacaagctccaccaagacggtaaacgctgcacagccactggaccccca
ccttatctgctgtttgccaacatagtaaacatcagacgtgttaatctggatgggactggt
gaccaaagccttgtggaggagccgagcggaacagtaatagctctggactatgatcccgta
caaaacaaagtgtactttgccagtacagtactgaaacagattgagcgtgctgatttggac
ggcgggtccagggaggttttgctcactgaggagttggactcaccagagggcctggctgtg
gactgggtcaaccgcaagctctactggactgaccgaggcctctcaactattgaccgcagc
accttggatggcttcgacagagagaccattattagcaaaggcatacagaaaccaagggga
attgcagttcatcctttagccaagaagttgttctggaccgatatgggtaccaggcctgtg
ttggagagtgcgtctttggaaggaagtgatcgtgcggtcatcgcaagcgccgacttggtg
tctcctagtggtctgaccattgacttcactgaagacaggctgtactggtgtgacagcaag
aggggcgtactggagacggcatccctggatggctccaaccgacaagtcttgacagagaac
gaagtaggtcaaccttttgacctggcagtgtttgaggacaggttgtggatcacggacagg
gagcagcagctgctcctgagcgttgacaaatggacggggatggacccagagcgtctccat
ggcaacatggtccaaccagcatccatagttgtggttcaccccctcgccaagccaggagca
aatgtttgtctctatcgaaatgggggctgtgctcaggtgtgtgagagcaggctaggattc
gcccactgctcctgtcactcacacattgcccaatcagctgatggcaaaggctgcttgcca
tcctacagatcaacaggtgatatgaactccaattctggagatggtgagtctgcagacccg
ttctctctgaaaaacaaaactttgaacgatgagagcatgcctctccctcccacactcttc
attgagacgatggtgtcagaccaggatgactgcttctctctccgctgtgatgtgaatgcg
caatgtctactggatggaggcaaccccacctgccactgcctggaaggtttcactggggat
ggagagctgtgtttggaccttgatgagtgcatgttggggatggccctgtgtagtatccag
agctcagtgtgtgtcaacactgctggtggatattactgccagtgtcgccctggcttcagt
ggagaggagcaccactgtaccgattttgacgagtgtaaaatgggaacacacaaatgtgat
gagcgagcggaatgcatcaatactatagggaagtaccgctgcaagtgtcaagctggctac
agtggtaatggacacacatgccaagagttgtcaactacgtcctcgtgggtgaccaccagt
aggcctatggacgtcaccagccaatggctgaacactaacacagtggagagctgcccctca
tctcatgacacttactgtctctacgagggagtctgcttgtacttcccagagatggagtcc
tatgcctgcaactgtatctcgggctacatgggagagcgctgtcagttcagtgatctggag
tggtgggagctacagcaggccgaacaagagaagagaaggaacgtggccatcgccctgggc
atggtggtcctcatcaccctgctctccattgctgcctgcgtcacctactgctacgggtcc
aggagatttgttcggaaacacccctcggtggatgacatgagcgagacaagcaccagtgat
gacaccatgtcagagaccaccgtccccaagacgccacgggtaagtctgaacccagttaat
ggtgacttccgtacagaaaaacaatga

DBGET integrated database retrieval system