KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257180Help
Entry
112257180         CDS       T05605                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00051  Fructose and mannose metabolism
otw00052  Galactose metabolism
otw00500  Starch and sucrose metabolism
otw00520  Amino sugar and nucleotide sugar metabolism
otw00524  Neomycin, kanamycin and gentamicin biosynthesis
otw01100  Metabolic pathways
otw01200  Carbon metabolism
otw04910  Insulin signaling pathway
Module
otw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
otw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112257180
   00051 Fructose and mannose metabolism
    112257180
   00052 Galactose metabolism
    112257180
   00500 Starch and sucrose metabolism
    112257180
   00520 Amino sugar and nucleotide sugar metabolism
    112257180
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    112257180
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112257180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112257180
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     112257180
Membrane trafficking [BR:otw04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    112257180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 112257180
NCBI-ProteinID: XP_024286502
LinkDB All DBs
Position
1
AA seq 960 aa AA seqDB search
MTHFSSFVWTETGIFFKPPHQGEGTTGISLFFSSPFILSPPVDRMIAAQLLAYYFTELKD
DKVKKIDKYLYAMRFSDETLMDIMKRFRRELGNGLGRDTNPTATVKMLPTFVRSIPDGSE
KGDFIALDLGGSAFRILRVKVSHEKKQTVQMESQIYDTPEDIIHGSGTRLFDHVAECLGD
FMEKQNIKDKKLSVGFTFSFPCAQTKLNESYLLTWTKRFKASGVEGMDVVTLLNKAIKKR
GDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVEGDEGRMC
INTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKE
GFLFEGRITPELLTKGKFETKHVSSIEKSKEGLAKAKDILGRLGVEPSADDCVAVQHVCT
IVSHRSANLLAATLGGILSRLKDNKGNPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLVP
ESDVRFLLSESGSSKGAAMVTAVAYRLADQRRQITETLAEFRLTSDQLLEVKKRMRTEIQ
NGLGKKTHDSATIKMWPTYVLSTPDGSENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMH
NKIYAIPMEVMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGFTFSFPCRQTSLDVGIL
VTWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGL
IAGTGSNACYMEEMRNIEVVEGDVGRMCVNMEWGAFGDNGCLDDIRTEYDRAVDDFSLNL
GKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLA
LLQVRSILQQLGLDSTCDDSIIVKEVCGTVSRRAAQLCGAGMAAVVDKIRENRGLNQMDI
TVGVDGTLYKLHPHFSGIMHQTVKELAPKCNVNFLLSEDGSGKGAALITAVGCRMREQKS
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgacccatttctctagctttgtttggactgaaactgggatcttttttaaacctcctcac
cagggagaggggactacagggatttcccttttttttagctctccgtttattctttcacca
ccggtggacaggatgatcgcagcacagcttctggcctactacttcacagagttgaaggat
gacaaagtcaaaaagatcgataagtacctgtatgccatgcgtttctccgacgagacgctg
atggacatcatgaaacgattcaggagggaactggggaatgggctgggtcgggacacgaac
cctacagcaactgtcaagatgctgcccaccttcgtcaggtccattcctgatggatcagag
aagggggacttcattgctctggatctgggaggctcggccttccgcatcctgcgagtgaag
gtgtcccatgagaagaagcagacggttcagatggagagccagatctatgacactccagag
gacatcatccatggcagtggcactcggctgtttgaccatgttgcagagtgcctgggtgac
ttcatggagaagcagaatatcaaggataagaagctttctgtcggcttcaccttctccttc
ccctgtgcacaaacaaaactgaatgagagttatttgctcacttggacaaaacgctttaaa
gccagtggagttgagggaatggacgttgtgactcttctgaacaaggccatcaaaaaacgt
ggggactatgatgcagacatcatggcagtggtcaatgacacagttggaaccatgatgacc
tgtggctttgatgaccagcgttgtgaagttggtatcatcataggcacaggtactaatgct
tgttacatggaggagctaaggcacattgacctggtggagggagacgagggcagaatgtgt
atcaacacagagtggggagcctttggggacgatggaatgctggaggacattcgcacagag
ttcgacagagaaattgacaggggctctctaaacccagggaaacagctgtttgagaagatg
gtcagtgggatgtacatgggcgaacttgtgcgactcatcctggtcaagatggccaaagag
ggatttttgtttgagggtcggataacgcctgaacttcttactaaagggaaatttgaaacc
aaacacgtttcttccattgaaaagagtaaagaaggcctcgctaaagccaaggatatccta
ggtcgcctgggtgtggaaccatccgcagatgactgcgttgctgtgcagcacgtatgcacc
atagtctcccacagatcagccaacctcctcgctgccactctgggcggcatcctctccagg
ctaaaggacaacaaagggaaccctcgcctacgcaccactgtgggcatcgacggctctctc
tacaagatgcacccgcaatatgcccggcgtctccacaaaacagtccgccgcctagttcct
gagtcagatgtccgcttcctgctctcagagagtgggagctccaagggcgctgccatggtg
accgctgtggcctaccggctggctgaccagcgtcgtcagatcacagagaccctggctgag
ttcagactgaccagtgaccagctgctggaggtgaagaagaggatgaggacagagatccag
aacggcctggggaaaaagacccatgacagcgccaccatcaagatgtggcccacatatgta
ctcagcacaccagatggatcagaaaatggtgatttcttggctttggatttaggagggaca
aactttagagtgctgttggtgaagattcgcagtggcaagcggcggacagtagagatgcat
aacaaaatttatgctattcctatggaggtgatgcaggggactggagaggagctgtttgac
cacattgtccagtgcatatctgacttcctggactacatgggtatgaagaacactcgcctg
cctctgggtttcaccttctctttcccctgcagacagaccagcttggatgtgggcatcctg
gtaacctggaccaaaggcttcaaagccactgactgtgaaggggaggatgttgtcgggctt
ctcagagaggggattaaaaggagagaggagtttgacttggacgtggtggcagtagttaat
gacacagtggggaccatgatgacatgtgcatatgaagagcctacctgtgaggtcggcctg
atcgcaggaactggcagcaacgcctgttacatggaggagatgaggaacattgaggtggtg
gagggggatgtggggaggatgtgtgtcaacatggagtggggcgccttcggggataatggg
tgcctggatgatatcaggacagaatatgacagagctgtggatgacttttcactcaacctt
ggaaagcagaggtatgagaagatgtgcagcggtatgtatctcggagagattgtgcgaaac
atactgatcgacttgacgaagcgtggctttctcttcagagggcagatatcagagactctg
aagaccagaggcattttcgaaactaagttcctctcccagattgaaagtgaccgtttggcg
ctactgcaggtgaggtccatcctgcagcagctgggtctggacagcacatgtgatgacagt
atcatcgtcaaggaggtgtgtggtacagtgtcccgccgggcggctcagctctgtggagcc
ggaatggctgccgttgtcgacaaaatccgagagaaccgtgggctgaaccaaatggacatc
accgttggggtggacggaacactctacaagctacatccacacttctcagggatcatgcat
cagacagtgaaagagttggcccctaagtgcaacgtcaacttccttctctctgaggacggg
agtggcaagggtgcagccctcatcactgctgtgggctgtcgcatgcgtgagcagaagagc
tga

DBGET integrated database retrieval system