KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258127
Entry
112258127         CDS       T05605                                 

Definition
(RefSeq) glucocorticoid receptor-like isoform X1
  KO
K05771  glucocorticoid receptor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112258127
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112258127
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:otw03310]
    112258127
Transcription factors [BR:otw03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    112258127
Nuclear receptors [BR:otw03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   112258127
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 112258127
NCBI-ProteinID: XP_024288028
LinkDB
Position
9
AA seq 752 aa
MDNQDKSLERGEEGSFSVNAGSSKSTTLTSVMHLPGSTPQPPATDSCNGLNVTKIQGELS
TAGTTSIGLPIEEAEVKLMGKALRMQNAQKQQQNPQQQQLFENFALLEESISDLNRSNTP
GSSVLGCSNYLLPLKTEDFSPMDKDRLDMETVSFGQSLKDLDVNERLFGDNTLDILRDLD
LPGSLSDLNEFYLADEAAFLSSLSVDDALLVEGNMETKPIVSSSGGNCKNVNGVGQQLGP
GISMSVIKTEKDSDTTFIQLYTPGVIKQENERQSYCQISSLDIPGTHSSVGSMSGPSYHY
RANTSTAVCVQQDQKPVFGLYPPLPSVSDGWNRGQEFGDGSGMSTPSFPVSFSSPTARPE
ASSSTSSAPAKHSGPTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGWRARQNTDGQ
HNYLCAGRNDCIIDRIRRKNCPACRFRKCLQAGMNLEARKNKKLIRFKGQQATTETNAPA
PDERACTLIPKSMPQLVPTMLSLLKAIEPEAIYSGYDSTIPDTSTRLMTTLNRLGGQQVV
SAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGGMLCFAPDLVINDE
RMKLPYMTDQCEQMLKISTEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMT
YIKELGKAIVKREENSSQNWQRFYQLTKLLDSMQEMVGGLLQICFYTFVNKSLSVEFPEM
LAEIISNQIPKFKDGSVKPLLFHHALNHDTMP
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggataaccaggacaagagcttagagagaggtgaagagggaagcttctcggttaacgca
ggcagttccaagtccaccacattaacttcagtgatgcatttgcctggctccacaccccag
cctccagccacagactcctgtaacggactgaatgtcactaagattcagggtgagctctcc
acagcagggacaacctccattggactccctatagaggaggctgaagtgaagttaatgggc
aaggccctgagaatgcagaatgcacagaaacagcagcagaatcctcaacagcagcagctg
tttgagaactttgctctgttggaggagagcatttcagatttgaatcgatccaacacccca
gggagctccgtacttggatgttctaattaccttctccctctgaaaactgaggacttttca
ccaatggataaggacaggcttgacatggagacggtcagctttggacagtccctgaaggac
ttggatgtcaacgagaggctctttggtgacaatacgctggacattctgcgggatttggac
ttgcctggctctctgtctgacctgaatgagttttacctggctgacgaggccgctttcctt
tcctccctgtcagtggatgatgccctgctcgttgaaggcaacatggaaaccaagcccata
gtcagtagcagtgggggaaactgtaaaaatgtgaatggtgtggggcagcaactgggccca
gggatctccatgtctgtcatcaagaccgagaaggactctgacaccaccttcatccagctt
tacaccccaggggtaatcaaacaggagaacgagcgccagagctactgtcagatatccagc
ctggacatacctggtacccacagctcggtgggctccatgagtgggccgagttaccactac
agagcaaacacatcgacggcagtgtgcgtacagcaggatcagaagcctgtctttggcctg
tatcctccactgccctcagtcagtgatggctggaacagaggccaggaatttggggatgga
tcagggatgtcaactccatcttttcctgtcagcttcagcagtccaacggccagacccgag
gccagcagctccacatcttcagcccctgccaagcacagcggtccaacccataagatctgc
ctggtgtgttctgacgaggcttctggctgccactatggagtcctcacctgcggaagctgc
aaggtcttcttcaagagggccgttgaaggatggagagcacgacaaaacacagatggacaa
cacaactatctgtgtgccgggaggaatgactgcatcatagacaggatccgcaggaagaac
tgtccggcgtgccgcttccgcaagtgtctccaagcagggatgaacctggaagcaaggaaa
aacaagaagctgatccgatttaaaggtcagcaggccacaacagagacaaacgctcccgca
cctgatgaaagggcctgcaccctgatcccaaagtccatgccccagctggtgcccaccatg
ctgtctctgcttaaagccattgagccagaggccatttactctggctacgacagcaccatc
cccgacacctccacccgccttatgaccaccctcaacaggttgggcggacagcaggtcgtt
tcagctgtcaagtgggccaagtccctaccagggttccggaaccttcacctggatgatcag
atgactctgctgcagtgctcctggctgttcctcatgtcattcggcctgggctggcgctcc
taccagcagtgtaacgggggtatgctgtgcttcgcccctgacctggttattaatgatgag
aggatgaagctgccctatatgaccgaccagtgtgagcagatgctgaagatctccactgag
tttgtgaggttgcaggtgtcctacgacgagtacctgtgtatgaaagtcctgctgctgctc
agcacagtaccaaaggatggattgaagagccaggctgtgtttgatgagatccgcatgacc
tacatcaaggagctggggaaggccatcgttaagcgggaagagaactccagccagaactgg
cagaggttctaccaactcactaagttactggactccatgcaggagatggtggggggcctc
ctgcagatctgcttctacacttttgtgaataaatcccttagtgtggagttccctgagatg
ctggccgagatcatcagcaaccagataccaaaattcaaagatgggagtgtcaagccgctt
ctgtttcatcatgccttaaaccatgacacaatgccttaa

DBGET integrated database retrieval system