KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258454
Entry
112258454         CDS       T05605                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04080  Neuroactive ligand-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112258454
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:otw04030]
    112258454
G protein-coupled receptors [BR:otw04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    112258454
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 112258454
NCBI-ProteinID: XP_024288596
LinkDB
Position
9
AA seq 362 aa
MESSGRGNACDYSHNVTFFYDYVGKEISRDWCVRDCVVVVLGLTICLIMILSNIMVMAAI
LINRRFHFPIYFLLANMAAADLFAGLAYTNLVLNTGPWTIRLSKQQWFIRNALVDMSLTA
SVANLLAVAVERHQTIITMQLHSKMTKRRVVLLIVCIWAVSIIMGLVPSMGWNCECQLSD
CSIIAPLYSRRYMIFWASLNLLTFSVMVAVYTRIYVYVRRKGKRMSQHSSHHLRHNETVF
NLMKTISIVLGVFVICWTPGLMTLLLDGIMGKDSHALTYEKYCLILAECNSLVNPIIYSF
RDEEMRRTFKCILCCLCRRSSDHQGEQSPVEFNTLQPEVDNGCEVKSEKANFTALQMIKT
EW
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggagagcagtggcaggggaaacgcgtgcgactacagccacaacgtcaccttcttctac
gattacgtaggtaaggagatcagcagagactggtgtgtcagggactgtgtggtcgtggtc
ctgggcctgaccatctgcctcattatgatcctgtccaacataatggtgatggcggccatc
ttgatcaaccgacgcttccacttccccatctacttcctgctagccaacatggccgctgcg
gacctgttcgccggcttggcctacaccaacctcgtgctcaacacaggaccctggaccatc
aggctgtccaagcagcaatggttcattaggaatgctctggtggacatgagcctgacggcg
tctgtggccaacctgctggctgtggcggtggagcgtcaccagaccataattaccatgcag
ctgcacagcaagatgaccaaacggcgggtggtgctgctgatcgtgtgtatctgggcagtg
tctatcatcatggggctggtcccttccatggggtggaactgtgagtgccagcttagcgac
tgctccatcatcgccccgctctacagccgcaggtatatgatcttctgggcgtctctcaac
ctgctcaccttttctgtcatggtggctgtgtacacacgcatctatgtctacgtgagacgt
aagggtaaacggatgtctcagcacagctcccaccatctgaggcacaacgagactgtcttt
aacctcatgaagactatctctattgtactgggtgtgtttgtcatctgttggacaccgggc
ctgatgactctgttgctagatgggatcatgggtaaagacagccatgccttgacctatgag
aagtactgtctgatcctggctgagtgtaactccctggttaaccctattatctactccttc
cgggacgaggagatgagaaggacctttaagtgtatcctgtgctgcctgtgtaggaggagt
tctgaccaccagggggagcagtcccctgtggagttcaacacactgcaaccagaggtagat
aatggttgtgaagtaaaatcagagaaagccaactttactgccctccagatgataaagaca
gagtggtga

DBGET integrated database retrieval system