KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258998Help
Entry
112258998         CDS       T05605                                 

Definition
(RefSeq) uncharacterized protein LOC112258998 isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    112258998
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112258998
Enzymes [BR:otw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     112258998
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     112258998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 112258998
NCBI-ProteinID: XP_024289457
LinkDB All DBs
Position
9
AA seq 2236 aa AA seqDB search
MDGCSKMSVMELCETDDLATSLVLDPLLGFSTHKMNVSPPPEVRRWGYLKETLLRFQRTH
DLQATFEALTVGDWACDYFTGLGTHRLELLKQHVYRYLCAFLLDSGVQIESCDRYSSETN
GAKITSTKHWFVGERMEVLLGCIAELSPADSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCRPNCKFVPGDKNGGCVKVVRPIAPGEEITCYYGDSFFGEDNEMCECCTCERKGE
GHFRHRERQPGCDDSNDLSGQKYRLRDTDLRLNRGKAPCPPTFRPTFTFSNSAIPSRNSF
TQQMKRNALMMSRKTKRLKQEGQRRISGMKQQRLIMPSLSEVVLRDLRVRVRRHTFNFLL
SCKDPTSKERALLHQLEHVETKDKWRKVQAALCCTTKENDKIEKSSNTCELNLKPFTLHS
SLSSQQNAGPAVCGQILGGKPLRVVEKVSVQTRISSRTRSMIRNCHTRQSVSRTKKKNKI
ICKRIELTKSICRKSNSASPQKHMDSCSGKDATHNVIKDIHGTNCITIENNTSGNNNDVA
YISNRTYTGGGGPKGSKAQDADHKPVDLKVEIKTIGESGTDGTLVASKPSGKRVEVCQSV
LDKAKKPGNHQKPISTPLVTTTPSTISLSSPSFDHVPVMSGLKQVTVSLIRVSVPGSVAE
ERACPGLEGKGIVRRESSVPVQAEQMARSATQGGEADTRVSRSQQKSMEEAGRELSDAEG
KKGVREMYFKAKINKVDVGREQTAVVKVDLLHGEKGAGEKVIEIEAAGGGGKVSVAGKGH
RGSVNDIDRGAKLNSKSVQSQVVGCDKRVLRGRNDVEEQSNGKAGGQNSKSCDSIVRKDG
GKNERVSEMGSSITMDKKGVVIKQVRVLLSDILRKDWDQKAGGSGSGNTGKKDLISSNHK
QMEDGREANNDGGKEVREQILSDAQTNSLPHATTQSGITSKRGKGRANKMKLEGPGQDLH
IHSPQSNEDLIPVKDRLSKSPPPSEYLQTHTQANIPLKKRMFRNSVETDSEQSINSPVSE
PSSKDLKPSTELRQNLTLCSGRETKAIKVLEDSGRGGLRSNRDPKSTVSEFGVQSRTQTF
KRTAKQNAMPRMLRPRVNQLEQDRPRRSAGKYKRGTRDSEVLENESDEDKHKAGHGEISL
DSKKEHVNEGGKKPESQLLNSLTSQTCKEENGKGQSLNFKIRFKRKRGKVWELDRPAGGE
DLIIEAEKSIDSQQLEPYRAILDSVSILNLEMEKGAQADGKETHDVRFWKRRKVRRGRLG
SLKDRGPILMNRQSEVVAVDSKEKKKGQGELSEVEINEVLDEVVYGVKQLPGEKGHTISS
EGMSVGVGGLQCDYQVTPSPVRICEKEKDIPSLAEDREQVKDTCIGVESTLVDSGXLHEH
KVKDEDQPLPRIKLRRKIQGVWEVDSQVLEQIEAESEKEKKEMTCVKPKEECPSQPPTCQ
KLNSAIKCNTLKDSSAVLQKKEPPPLTLSLSPLTLNSPQPLGSDVMAYAPETMNERAMPK
ITNRGGRGRGRGRKERQKTETARKVATGEMGTSCLSHNLLQIDNSLSKLSEGLCQSQSLE
KNIPSDYTASTSKIPSQSQSPPFSFPERMLSTESSFANCCEDLLDFQCLNLEGFYHPQNI
LQTSPIDLCPMDPPSGPFSSPLSHSPSDAWNPETPYLGPPSPGSIFNAEDQQFLNGLVCS
KNESLDCGVKDTSKDRGQLNANFCFTPLSSAEGTFMDRFLMKNPGMKLSKEDSKTQALSS
AAKTHYSQKESFMFNANTPSIGSHSHNNPVNVHHQSTNGTKASSAHSNFSKVQPQVKIPG
PFHLMSSSNKSQSFSTSQPVPSSFKTVPQNYSVKSVHSPQVVSNKFGSQLNPNVGDAFRN
TYDKSSSVIQSVLKFQGGKPSQNLNSAPSKVNIVAGNPKIAAKAHIAKSRYSDTDKVHQS
NKCSGFSTGGHKGSMPSYSIISGKDPVRLNASNYPIKSNLPNDKVHPDYFQTSSKSTTTA
LEKPPSDKPQYTETSFGSKNFSTLPRPFFFPSHAPQSYGSHGKRLNQDKPCGAVHSQNPH
SSYATSASPDKLCYDSSDLTFSTSLSPSMSQHNSPQVTHSSPSGSQTPANKQQPPSSSFS
YSYGHQGPPYVVNFTGDHSVTMGLGDYPGSPPTNYTYRCLMEPSGTQGRLVLEPCGPQLS
HSPSFSVGGFSGLKGQDDHCKRDTQQQCQPIDHPPTSHHAPTSSHSLSTPVSDRKPKRLR
LVVTDGLVDLDLQYTD
NT seq 6711 nt NT seq  +upstreamnt  +downstreamnt
atggacggatgcagtaaaatgagtgtgatggagctgtgtgagacggatgatctggccacc
agcttggtgctggaccccttgctggggttcagcacccataaaatgaacgtcagtcccccc
ccagaggtccgtcgttggggctacctcaaagagactctgctacgcttccaacgcacacat
gacttgcaggccacctttgaggccctcacagtgggagactgggcctgtgactacttcact
ggactgggaacacaccgtctggaactactgaaacagcatgtgtatcgctacctctgtgcc
ttcctgttggatagtggtgtccagattgagtcatgtgaccgatactcttcagaaaccaac
ggagcaaagataacctctaccaagcactggtttgtaggtgagcggatggaggttctgttg
ggttgtatagccgagctgagtccagcagacagtgctgttctgagagcaggggtgaatgac
tttagtgtgatgtactctactcgtaagcgctgtgcacaactctggcttgggcctgcggct
ttcatcaaccacgactgcagaccaaactgtaagtttgtacctggcgataagaatggaggc
tgtgtaaaagtggtgaggcccatcgcacctggggaggagatcacctgttactatggcgac
agcttttttggagaagacaatgaaatgtgtgaatgctgcacctgtgagagaaaaggagag
ggtcacttccgacacagagagaggcagcctggttgtgatgactctaatgacctgtctggc
cagaagtaccgcctcagagacacagaccttcgtcttaacagagggaaagcaccctgtcct
cctacatttcggcctacatttacattttcaaattcagctatcccttcaaggaattcattt
acccagcagatgaagagaaatgctctgatgatgagcaggaagaccaaaaggttgaaacag
gaggggcaaaggaggatatcgggaatgaagcagcaacggctgataatgccatccctatca
gaggtggtgttgagggaccttcgggtccgagtacggcgccacacgttcaacttcttgttg
agctgcaaggaccccaccagcaaagagagggccttgctgcatcagcttgaacatgtggag
acaaaagacaagtggaggaaggtacaagctgctctctgctgtacaaccaaagagaatgac
aaaatagagaagagcagcaatacttgtgagttaaacctgaagcctttcactcttcactct
tccttgtcttctcaacagaatgctggaccagcagtttgtggacagatactgggtggaaag
ccccttcgagtggtggaaaaagtatctgtccagacaaggatctcttccagaacaaggagc
atgatcagaaactgtcacacacgccagtctgtttccagaaccaagaagaagaacaaaatc
atttgcaagcgcattgaactcaccaaatccatttgcagaaaaagcaacagcgcaagtcct
cagaaacacatggatagctgtagtggaaaagatgccacgcacaatgttatcaaagatatt
catggaaccaattgcataaccattgaaaataacaccagcggtaacaacaatgatgtggca
tacatcagcaacagaacatacactggtggaggcgggcccaaaggcagcaaggctcaggat
gcagatcacaaaccagtggatctgaaagtggaaatcaaaaccattggagaatcggggact
gacgggacacttgtggcgagcaaaccctctggtaaaagagttgaagtttgccaaagtgtt
ttggacaaagccaagaagcctgggaatcaccagaaacccattagtactccccttgtcact
accacccctagcaccatttccctctcttccccctcatttgaccatgttccggtaatgtca
ggactgaagcaagtcacagttagcttgataagagtgtctgtgccgggaagtgtagcagaa
gaaagggcctgtccaggattggagggaaagggcattgtgagaagagagagcagcgtacca
gtgcaagcagaacagatggctagatcagctacacagggaggagaggcagacaccagagtg
tccaggtcccagcagaagtccatggaggaagcaggcagggagttgtcagacgctgaaggt
aagaaaggggtgagggaaatgtatttcaaggctaagattaacaaagttgatgtaggaagg
gaacagactgctgtggtgaaggtcgatttattacatggtgagaaaggggcaggtgagaag
gtcattgaaatagaagctgctggtgggggggggaaggttagtgtggctgggaaggggcat
agggggagtgtaaacgacattgatagaggggcaaaactaaatagtaaaagtgtacaatct
caagttgttggctgtgataagagggtgcttagagggcgaaatgatgtagaagaacagagt
aatggaaaagcaggaggacaaaatagcaaaagttgtgacagcattgtcagaaaggatgga
ggtaagaatgagagggtgtctgaaatggggagtagtataactatggacaagaagggtgtt
gtcatcaaacaggtgagggttctgctttctgatattctaagaaaagattgggatcagaag
gctgggggttcaggaagtgggaacacaggaaagaaagatctaatttcctccaaccataaa
caaatggaagatggcagagaggcaaataatgatggagggaaagaggttagggaacaaata
ttatctgatgcacagacaaatagtttgcctcatgcaacaacacaaagtgggataacttcc
aaacgggggaaaggaagggctaataagatgaaacttgagggtccaggtcaagacttgcat
attcactcgccacaaagtaatgaggatttaatcccagtgaaagataggctttccaagtct
ccccctccttcagaatatcttcagacacacacccaggccaacattcctctgaagaaacgg
atgttccgtaattcggtggagactgactctgagcagagcatcaactctcctgtgtcagag
ccatcctccaaggacctcaaaccttccacagagctgaggcagaatcttactctgtgttca
ggaagagaaactaaagctatcaaagtgttggaggacagcggtagaggtgggttgcggtct
aatagggaccctaagtctaccgtttcagagtttggggtccaatctcggacacagaccttc
aagaggacagcaaaacaaaatgcaatgcccagaatgctgcgtcccagagtcaatcaactg
gaacaagaccggccacggaggagtgcaggaaagtataaaagagggacccgagactcagag
gtactggagaatgaatctgatgaggacaaacacaaagcaggacatggtgaaatctcactg
gattctaaaaaagaacatgtaaatgaaggagggaagaagccagaatcacagttactgaat
tcactcacctcacaaacatgcaaggaagagaacgggaaagggcagagcctcaacttcaaa
attcgttttaagagaaagaggggcaaagtgtgggagttggacagacctgcaggaggagag
gatttgattattgaagcagaaaagtctattgattcacaacaattggagccttatagggcc
attttagattctgtgtcaatcttaaacttagaaatggagaagggtgcccaggcagatggg
aaggagactcatgacgtacgattttggaagagacgtaaagttagacgaggcagattgggg
agtttgaaagatagaggtcccattttgatgaacaggcagagtgaggttgtagctgtagac
tcaaaagagaaaaaaaaaggacagggggagctcagcgaggtagagataaatgaggtgcta
gacgaggttgtttatggagtaaagcaactgccaggagaaaagggccatacaatttctagt
gagggtatgtctgtcggagtggggggactgcaatgtgactatcaagtcacaccaagtcct
gttagaatctgtgaaaaagagaaagatattccatccttggctgaagacagagaacaagtg
aaggatacttgtattggagtagaragtactttggttgacagtggggmactgcatgaacac
aaagtaaaggatgaagaccaacccttrccacggatcaaactgcggagaaaaatacagggt
gtatgggaggtggacagccaggtgttggagcagattgaagcagagtctgaaaaagagaag
aaggaaatgacatgcgttaagccaaaagaagagtgcccttctcaacctcccacctgccag
aaactcaacagtgcaatcaagtgcaacactttaaaagattcctctgctgttcttcagaaa
aaagaacctccccccctcactttatctctctcacccttgacccttaactcaccccaacct
ttgggttctgatgtgatggcctatgctcctgaaacaatgaatgagagggccatgccaaaa
atcactaataggggaggaaggggaaggggaaggggacggaaagaaaggcagaaaacagag
actgctcgtaaggttgcaactggagagatgggaacttcttgtcttagtcataacctgcta
cagatagacaatagtctttctaaactctcagaagggttatgtcagtcacaatccttagaa
aaaaacataccttctgattacactgcttccacctcaaagattccatcccagtctcagtct
ccaccgttcagttttccagaaaggatgctttccacagaatccagctttgctaattgctgt
gaagatctcctcgacttccagtgtctcaatcttgaagggttctatcatccacagaacatc
ctccaaacctccccaatagacctctgtccaatggatccacccagcgggccctttagtagt
cccctctctcatagcccctcggatgcttggaacccagaaaccccataccttggccctcca
agcccaggaagtatcttcaatgcagaggatcagcaatttcttaatggtcttgtgtgctcc
aaaaatgagtctctggattgtggagttaaggatacttccaaagacagaggacagctcaat
gcaaatttttgttttacacccctgagcagcgctgaggggactttcatggatcgttttttg
atgaaaaatcctgggatgaaattgtcaaaagaagattctaagacacaggccttatcttca
gcagccaaaacccactactctcagaaagaatcattcatgtttaatgcaaatactccatcc
atcggttcccattcccacaataacccagtcaatgttcaccatcagagcaccaatggtact
aaggctagttctgctcattccaatttttctaaggtccagcctcaagtcaaaattccgggt
cccttccacctgatgagctcttccaacaaatctcaatctttttccacctctcagccagtg
ccaagttccttcaaaactgtgccccagaattactcagtcaagtccgtccattcacctcaa
gtggtttctaacaagtttggctcacaattaaatcctaatgtaggagatgcttttcgcaac
acgtatgacaaaagctccagtgtgatccagagtgtgcttaagtttcaaggagggaaacca
agtcagaatttgaatagtgccccttctaaagttaatattgtcgctggcaaccctaaaatt
gcggccaaagctcatattgccaaatctaggtacagtgacactgacaaggtccaccagagt
aacaaatgttcaggttttagcactggcggccataaaggtagcatgcccagttatagcatc
atttcaggaaaagatccagttcgtctcaatgcatcaaactaccccatcaagtcaaatctt
cccaatgacaaagtccatccagattatttccagacatccagtaaaagtacaacgacagct
ttggagaagcctccctctgacaaacctcaatacactgaaaccagctttggcagcaaaaac
ttctccactctcccaaggcctttctttttccccagccacgcacctcagagttatggttct
catggcaaacgtttgaatcaggacaagccctgtggtgctgtgcactcccagaaccctcac
tcttcctatgccacatcggcgtcacctgacaaactgtgttacgattcctcagacttgacc
ttttccacctcgctctctccctctatgtctcagcacaatagcccccaagtaacacacagc
tctccctctggatcacagacaccagcaaacaaacagcagcccccctcctcctccttctcc
tactcttatggtcaccaaggtccaccttatgtggtcaattttactggtgaccactcagtc
accatgggcctgggagattacccagggtcaccgcccaccaactatacgtaccgctgcctc
atggagccttcgggcacccaggggaggctagttctggagccatgtggaccccaactctca
cactcaccatctttctctgtggggggcttttcagggcttaaaggccaggatgaccactgc
aagagggacacgcaacagcagtgccagcccatagaccacccaccaacatcccaccatgct
cccacatcctcccactccttgagtaccccggtctcagaccgtaagcccaaaagactgagg
ctagtggttactgatgggctagtggatctggacctccagtatacagactga

DBGET integrated database retrieval system