KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258998
Entry
112258998         CDS       T05605                                 

Definition
(RefSeq) uncharacterized protein LOC112258998 isoform X1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 112258998
NCBI-ProteinID: XP_024289457
LinkDB
Position
9
AA seq 2236 aa
MDGCSKMSVMELCETDDLATSLVLDPLLGFSTHKMNVSPPPEVRRWGYLKETLLRFQRTH
DLQATFEALTVGDWACDYFTGLGTHRLELLKQHVYRYLCAFLLDSGVQIESCDRYSSETN
GAKITSTKHWFVGERMEVLLGCIAELSPADSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCRPNCKFVPGDKNGGCVKVVRPIAPGEEITCYYGDSFFGEDNEMCECCTCERKGE
GHFRHRERQPGCDDSNDLSGQKYRLRDTDLRLNRGKAPCPPTFRPTFTFSNSAIPSRNSF
TQQMKRNALMMSRKTKRLKQEGQRRISGMKQQRLIMPSLSEVVLRDLRVRVRRHTFNFLL
SCKDPTSKERALLHQLEHVETKDKWRKVQAALCCTTKENDKIEKSSNTCELNLKPFTLHS
SLSSQQNAGPAVCGQILGGKPLRVVEKVSVQTRISSRTRSMIRNCHTRQSVSRTKKKNKI
ICKRIELTKSICRKSNSASPQKHMDSCSGKDATHNVIKDIHGTNCITIENNTSGNNNDVA
YISNRTYTGGGGPKGSKAQDADHKPVDLKVEIKTIGESGTDGTLVASKPSGKRVEVCQSV
LDKAKKPGNHQKPISTPLVTTTPSTISLSSPSFDHVPVMSGLKQVTVSLIRVSVPGSVAE
ERACPGLEGKGIVRRESSVPVQAEQMARSATQGGEADTRVSRSQQKSMEEAGRELSDAEG
KKGVREMYFKAKINKVDVGREQTAVVKVDLLHGEKGAGEKVIEIEAAGGGGKVSVAGKGH
RGSVNDIDRGAKLNSKSVQSQVVGCDKRVLRGRNDVEEQSNGKAGGQNSKSCDSIVRKDG
GKNERVSEMGSSITMDKKGVVIKQVRVLLSDILRKDWDQKAGGSGSGNTGKKDLISSNHK
QMEDGREANNDGGKEVREQILSDAQTNSLPHATTQSGITSKRGKGRANKMKLEGPGQDLH
IHSPQSNEDLIPVKDRLSKSPPPSEYLQTHTQANIPLKKRMFRNSVETDSEQSINSPVSE
PSSKDLKPSTELRQNLTLCSGRETKAIKVLEDSGRGGLRSNRDPKSTVSEFGVQSRTQTF
KRTAKQNAMPRMLRPRVNQLEQDRPRRSAGKYKRGTRDSEVLENESDEDKHKAGHGEISL
DSKKEHVNEGGKKPESQLLNSLTSQTCKEENGKGQSLNFKIRFKRKRGKVWELDRPAGGE
DLIIEAEKSIDSQQLEPYRAILDSVSILNLEMEKGAQADGKETHDVRFWKRRKVRRGRLG
SLKDRGPILMNRQSEVVAVDSKEKKKGQGELSEVEINEVLDEVVYGVKQLPGEKGHTISS
EGMSVGVGGLQCDYQVTPSPVRICEKEKDIPSLAEDREQVKDTCIGVESTLVDSGXLHEH
KVKDEDQPLPRIKLRRKIQGVWEVDSQVLEQIEAESEKEKKEMTCVKPKEECPSQPPTCQ
KLNSAIKCNTLKDSSAVLQKKEPPPLTLSLSPLTLNSPQPLGSDVMAYAPETMNERAMPK
ITNRGGRGRGRGRKERQKTETARKVATGEMGTSCLSHNLLQIDNSLSKLSEGLCQSQSLE
KNIPSDYTASTSKIPSQSQSPPFSFPERMLSTESSFANCCEDLLDFQCLNLEGFYHPQNI
LQTSPIDLCPMDPPSGPFSSPLSHSPSDAWNPETPYLGPPSPGSIFNAEDQQFLNGLVCS
KNESLDCGVKDTSKDRGQLNANFCFTPLSSAEGTFMDRFLMKNPGMKLSKEDSKTQALSS
AAKTHYSQKESFMFNANTPSIGSHSHNNPVNVHHQSTNGTKASSAHSNFSKVQPQVKIPG
PFHLMSSSNKSQSFSTSQPVPSSFKTVPQNYSVKSVHSPQVVSNKFGSQLNPNVGDAFRN
TYDKSSSVIQSVLKFQGGKPSQNLNSAPSKVNIVAGNPKIAAKAHIAKSRYSDTDKVHQS
NKCSGFSTGGHKGSMPSYSIISGKDPVRLNASNYPIKSNLPNDKVHPDYFQTSSKSTTTA
LEKPPSDKPQYTETSFGSKNFSTLPRPFFFPSHAPQSYGSHGKRLNQDKPCGAVHSQNPH
SSYATSASPDKLCYDSSDLTFSTSLSPSMSQHNSPQVTHSSPSGSQTPANKQQPPSSSFS
YSYGHQGPPYVVNFTGDHSVTMGLGDYPGSPPTNYTYRCLMEPSGTQGRLVLEPCGPQLS
HSPSFSVGGFSGLKGQDDHCKRDTQQQCQPIDHPPTSHHAPTSSHSLSTPVSDRKPKRLR
LVVTDGLVDLDLQYTD
NT seq 6711 nt   +upstreamnt  +downstreamnt
atggacggatgcagtaaaatgagtgtgatggagctgtgtgagacggatgatctggccacc
agcttggtgctggaccccttgctggggttcagcacccataaaatgaacgtcagtcccccc
ccagaggtccgtcgttggggctacctcaaagagactctgctacgcttccaacgcacacat
gacttgcaggccacctttgaggccctcacagtgggagactgggcctgtgactacttcact
ggactgggaacacaccgtctggaactactgaaacagcatgtgtatcgctacctctgtgcc
ttcctgttggatagtggtgtccagattgagtcatgtgaccgatactcttcagaaaccaac
ggagcaaagataacctctaccaagcactggtttgtaggtgagcggatggaggttctgttg
ggttgtatagccgagctgagtccagcagacagtgctgttctgagagcaggggtgaatgac
tttagtgtgatgtactctactcgtaagcgctgtgcacaactctggcttgggcctgcggct
ttcatcaaccacgactgcagaccaaactgtaagtttgtacctggcgataagaatggaggc
tgtgtaaaagtggtgaggcccatcgcacctggggaggagatcacctgttactatggcgac
agcttttttggagaagacaatgaaatgtgtgaatgctgcacctgtgagagaaaaggagag
ggtcacttccgacacagagagaggcagcctggttgtgatgactctaatgacctgtctggc
cagaagtaccgcctcagagacacagaccttcgtcttaacagagggaaagcaccctgtcct
cctacatttcggcctacatttacattttcaaattcagctatcccttcaaggaattcattt
acccagcagatgaagagaaatgctctgatgatgagcaggaagaccaaaaggttgaaacag
gaggggcaaaggaggatatcgggaatgaagcagcaacggctgataatgccatccctatca
gaggtggtgttgagggaccttcgggtccgagtacggcgccacacgttcaacttcttgttg
agctgcaaggaccccaccagcaaagagagggccttgctgcatcagcttgaacatgtggag
acaaaagacaagtggaggaaggtacaagctgctctctgctgtacaaccaaagagaatgac
aaaatagagaagagcagcaatacttgtgagttaaacctgaagcctttcactcttcactct
tccttgtcttctcaacagaatgctggaccagcagtttgtggacagatactgggtggaaag
ccccttcgagtggtggaaaaagtatctgtccagacaaggatctcttccagaacaaggagc
atgatcagaaactgtcacacacgccagtctgtttccagaaccaagaagaagaacaaaatc
atttgcaagcgcattgaactcaccaaatccatttgcagaaaaagcaacagcgcaagtcct
cagaaacacatggatagctgtagtggaaaagatgccacgcacaatgttatcaaagatatt
catggaaccaattgcataaccattgaaaataacaccagcggtaacaacaatgatgtggca
tacatcagcaacagaacatacactggtggaggcgggcccaaaggcagcaaggctcaggat
gcagatcacaaaccagtggatctgaaagtggaaatcaaaaccattggagaatcggggact
gacgggacacttgtggcgagcaaaccctctggtaaaagagttgaagtttgccaaagtgtt
ttggacaaagccaagaagcctgggaatcaccagaaacccattagtactccccttgtcact
accacccctagcaccatttccctctcttccccctcatttgaccatgttccggtaatgtca
ggactgaagcaagtcacagttagcttgataagagtgtctgtgccgggaagtgtagcagaa
gaaagggcctgtccaggattggagggaaagggcattgtgagaagagagagcagcgtacca
gtgcaagcagaacagatggctagatcagctacacagggaggagaggcagacaccagagtg
tccaggtcccagcagaagtccatggaggaagcaggcagggagttgtcagacgctgaaggt
aagaaaggggtgagggaaatgtatttcaaggctaagattaacaaagttgatgtaggaagg
gaacagactgctgtggtgaaggtcgatttattacatggtgagaaaggggcaggtgagaag
gtcattgaaatagaagctgctggtgggggggggaaggttagtgtggctgggaaggggcat
agggggagtgtaaacgacattgatagaggggcaaaactaaatagtaaaagtgtacaatct
caagttgttggctgtgataagagggtgcttagagggcgaaatgatgtagaagaacagagt
aatggaaaagcaggaggacaaaatagcaaaagttgtgacagcattgtcagaaaggatgga
ggtaagaatgagagggtgtctgaaatggggagtagtataactatggacaagaagggtgtt
gtcatcaaacaggtgagggttctgctttctgatattctaagaaaagattgggatcagaag
gctgggggttcaggaagtgggaacacaggaaagaaagatctaatttcctccaaccataaa
caaatggaagatggcagagaggcaaataatgatggagggaaagaggttagggaacaaata
ttatctgatgcacagacaaatagtttgcctcatgcaacaacacaaagtgggataacttcc
aaacgggggaaaggaagggctaataagatgaaacttgagggtccaggtcaagacttgcat
attcactcgccacaaagtaatgaggatttaatcccagtgaaagataggctttccaagtct
ccccctccttcagaatatcttcagacacacacccaggccaacattcctctgaagaaacgg
atgttccgtaattcggtggagactgactctgagcagagcatcaactctcctgtgtcagag
ccatcctccaaggacctcaaaccttccacagagctgaggcagaatcttactctgtgttca
ggaagagaaactaaagctatcaaagtgttggaggacagcggtagaggtgggttgcggtct
aatagggaccctaagtctaccgtttcagagtttggggtccaatctcggacacagaccttc
aagaggacagcaaaacaaaatgcaatgcccagaatgctgcgtcccagagtcaatcaactg
gaacaagaccggccacggaggagtgcaggaaagtataaaagagggacccgagactcagag
gtactggagaatgaatctgatgaggacaaacacaaagcaggacatggtgaaatctcactg
gattctaaaaaagaacatgtaaatgaaggagggaagaagccagaatcacagttactgaat
tcactcacctcacaaacatgcaaggaagagaacgggaaagggcagagcctcaacttcaaa
attcgttttaagagaaagaggggcaaagtgtgggagttggacagacctgcaggaggagag
gatttgattattgaagcagaaaagtctattgattcacaacaattggagccttatagggcc
attttagattctgtgtcaatcttaaacttagaaatggagaagggtgcccaggcagatggg
aaggagactcatgacgtacgattttggaagagacgtaaagttagacgaggcagattgggg
agtttgaaagatagaggtcccattttgatgaacaggcagagtgaggttgtagctgtagac
tcaaaagagaaaaaaaaaggacagggggagctcagcgaggtagagataaatgaggtgcta
gacgaggttgtttatggagtaaagcaactgccaggagaaaagggccatacaatttctagt
gagggtatgtctgtcggagtggggggactgcaatgtgactatcaagtcacaccaagtcct
gttagaatctgtgaaaaagagaaagatattccatccttggctgaagacagagaacaagtg
aaggatacttgtattggagtagaragtactttggttgacagtggggmactgcatgaacac
aaagtaaaggatgaagaccaacccttrccacggatcaaactgcggagaaaaatacagggt
gtatgggaggtggacagccaggtgttggagcagattgaagcagagtctgaaaaagagaag
aaggaaatgacatgcgttaagccaaaagaagagtgcccttctcaacctcccacctgccag
aaactcaacagtgcaatcaagtgcaacactttaaaagattcctctgctgttcttcagaaa
aaagaacctccccccctcactttatctctctcacccttgacccttaactcaccccaacct
ttgggttctgatgtgatggcctatgctcctgaaacaatgaatgagagggccatgccaaaa
atcactaataggggaggaaggggaaggggaaggggacggaaagaaaggcagaaaacagag
actgctcgtaaggttgcaactggagagatgggaacttcttgtcttagtcataacctgcta
cagatagacaatagtctttctaaactctcagaagggttatgtcagtcacaatccttagaa
aaaaacataccttctgattacactgcttccacctcaaagattccatcccagtctcagtct
ccaccgttcagttttccagaaaggatgctttccacagaatccagctttgctaattgctgt
gaagatctcctcgacttccagtgtctcaatcttgaagggttctatcatccacagaacatc
ctccaaacctccccaatagacctctgtccaatggatccacccagcgggccctttagtagt
cccctctctcatagcccctcggatgcttggaacccagaaaccccataccttggccctcca
agcccaggaagtatcttcaatgcagaggatcagcaatttcttaatggtcttgtgtgctcc
aaaaatgagtctctggattgtggagttaaggatacttccaaagacagaggacagctcaat
gcaaatttttgttttacacccctgagcagcgctgaggggactttcatggatcgttttttg
atgaaaaatcctgggatgaaattgtcaaaagaagattctaagacacaggccttatcttca
gcagccaaaacccactactctcagaaagaatcattcatgtttaatgcaaatactccatcc
atcggttcccattcccacaataacccagtcaatgttcaccatcagagcaccaatggtact
aaggctagttctgctcattccaatttttctaaggtccagcctcaagtcaaaattccgggt
cccttccacctgatgagctcttccaacaaatctcaatctttttccacctctcagccagtg
ccaagttccttcaaaactgtgccccagaattactcagtcaagtccgtccattcacctcaa
gtggtttctaacaagtttggctcacaattaaatcctaatgtaggagatgcttttcgcaac
acgtatgacaaaagctccagtgtgatccagagtgtgcttaagtttcaaggagggaaacca
agtcagaatttgaatagtgccccttctaaagttaatattgtcgctggcaaccctaaaatt
gcggccaaagctcatattgccaaatctaggtacagtgacactgacaaggtccaccagagt
aacaaatgttcaggttttagcactggcggccataaaggtagcatgcccagttatagcatc
atttcaggaaaagatccagttcgtctcaatgcatcaaactaccccatcaagtcaaatctt
cccaatgacaaagtccatccagattatttccagacatccagtaaaagtacaacgacagct
ttggagaagcctccctctgacaaacctcaatacactgaaaccagctttggcagcaaaaac
ttctccactctcccaaggcctttctttttccccagccacgcacctcagagttatggttct
catggcaaacgtttgaatcaggacaagccctgtggtgctgtgcactcccagaaccctcac
tcttcctatgccacatcggcgtcacctgacaaactgtgttacgattcctcagacttgacc
ttttccacctcgctctctccctctatgtctcagcacaatagcccccaagtaacacacagc
tctccctctggatcacagacaccagcaaacaaacagcagcccccctcctcctccttctcc
tactcttatggtcaccaaggtccaccttatgtggtcaattttactggtgaccactcagtc
accatgggcctgggagattacccagggtcaccgcccaccaactatacgtaccgctgcctc
atggagccttcgggcacccaggggaggctagttctggagccatgtggaccccaactctca
cactcaccatctttctctgtggggggcttttcagggcttaaaggccaggatgaccactgc
aagagggacacgcaacagcagtgccagcccatagaccacccaccaacatcccaccatgct
cccacatcctcccactccttgagtaccccggtctcagaccgtaagcccaaaagactgagg
ctagtggttactgatgggctagtggatctggacctccagtatacagactga

DBGET integrated database retrieval system