KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259609Help
Entry
112259609         CDS       T05605                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00250  Alanine, aspartate and glutamate metabolism
otw00410  beta-Alanine metabolism
otw00430  Taurine and hypotaurine metabolism
otw00650  Butanoate metabolism
otw01100  Metabolic pathways
Module
otw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112259609
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112259609
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112259609
   00430 Taurine and hypotaurine metabolism
    112259609
Enzymes [BR:otw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112259609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SHMT DegT_DnrJ_EryC1 SepSecS DUF3586
Motif
Other DBs
NCBI-GeneID: 112259609
NCBI-ProteinID: XP_024290008
LinkDB All DBs
Position
10
AA seq 569 aa AA seqDB search
MQTCQYCIGSSCTPGLIVPESIIEHAKPGGQVLAESIQHRSSSDINPPQTASDNTCSITK
DFSCIYSKDLLPALRGEDTTKSFFQELVNILLSYVCKSFRRSSKVLDFHHPHQLREGLEG
FSLELPDQPENLEQLLVDCRDTLKYGVKTGHPRFFNQLSSGLDVIGLAGEWLTSTANTNM
FTYEVSPVFILMEEILLRKMQEIVGWSEEEGDGVFCPGGTMSNLYSVLLARYHFFPEVKT
KGMTALPRLILFTSAHSHYSVKKSAAVLGIGSDNVVVVKCNDRGKMITAELESSIITAKD
QGCVPFYVNATAGTTVYGAFDPLNAIADICESHGLWLHVDAAWGGGLLMSKRHRVKLQGI
ERAWSVTWNPHKMMGAPLQCSAILVKKRGLLKDCNQMCAEYLFQTDKHYDTSYDTGDKTI
QCGRHVDVFKLWLMWKAKGSEGFESQVNKCLENAEHLFDKLKQRPDFELVFKSEPEHSNV
CFWYIPPSLRNMSPGPERNRRLHEVAPKIKAKMMEQGMAMIGYQPLGDKVNFFRCVFSNP
ATQTEDVDYLLEEIASLGHDICIRTETDL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcagacatgtcaatattgtattggatcatcatgtactccgggtttaattgttccagaa
agcataattgaacatgctaaaccaggtgggcaggttttggcagagagtatacagcacaga
agctcatctgacatcaaccctccacagacagcaagtgataacacctgcagcataaccaag
gacttcagttgcatctacagcaaagatctactccctgctctccgtggtgaggacacaacc
aaaagtttcttccaagagctggtgaacattctcctcagctatgtctgcaagtcgttcaga
cggagctccaaagtcctggacttccaccaccctcaccaactcagagagggcctggagggc
ttcagtctggagctcccagaccagcccgagaacctggaacaactcctggtcgactgcagg
gacaccttgaagtatggagtcaaaacaggtcacccacgcttcttcaatcagctgtcatca
ggtctggatgtcatcggtttggccggggaatggctgacatctactgccaacacaaacatg
tttacttatgaagtgtccccagtgttcattctgatggaggagattctactgaggaagatg
caagagattgtgggttggtcagaggaagagggggatggtgttttctgtccaggtgggacc
atgtccaatctgtacagtgtactactggccagataccacttctttcctgaagtgaagacc
aaagggatgactgctctgcccaggctaatcctcttcacatcagcacatagtcattattca
gtcaagaaatctgcagcagtccttgggataggaagtgataatgttgtggtggtgaaatgt
aatgaccggggaaaratgatcactgcagaattggagtcaagtatcattactgccaaagat
cagggttgtgtcccattctacgtcaatgccacagcaggcaccactgtgtacggagccttt
gatcctctcaatgccatcgcagacatctgtgagagccatggactctggctgcatgttgat
gcagcctggggcggaggactgttgatgtccaagcggcaccgtgtgaaactacaagggatt
gaacgagcctggtctgtgacttggaaccctcataaaatgatgggtgctccgctgcaatgc
tcagccatactggtgaagaaaaggggcctcttgaaagactgcaatcagatgtgtgctgaa
taccttttccaaactgacaagcactacgacacctcttatgacaccggagacaagaccatt
cagtgtggcaggcatgttgatgtcttcaagctctggctcatgtggaaggccaagggttca
gaaggcttcgaatcacaggtcaataaatgtttggaaaatgctgagcacttgtttgacaaa
ctcaaacaaagaccagactttgaacttgtcttcaaaagcgaacctgaacacagcaacgtg
tgcttctggtacatyccaccaagtctgaggaacatgtcaccaggtcctgagaggaacagg
agactccacgaggtggcaccaaagatcaaagccaagatgatggagcaggggatggccatg
attggctatcagccgctcggagacaaagttaacttcttccgatgtgtcttctccaaccca
gccacacagacagaggatgtggactacctcttggaggagatcgcttctcttggtcatgac
atctgcatcaggactgaaaccgatttgtga

DBGET integrated database retrieval system