KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260059
Entry
112260059         CDS       T05605                                 

Definition
(RefSeq) transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04210  Apoptosis
otw04218  Cellular senescence
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04623  Cytosolic DNA-sensing pathway
otw04625  C-type lectin receptor signaling pathway
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112260059
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112260059
  09143 Cell growth and death
   04210 Apoptosis
    112260059
   04218 Cellular senescence
    112260059
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112260059
   04621 NOD-like receptor signaling pathway
    112260059
   04622 RIG-I-like receptor signaling pathway
    112260059
   04623 Cytosolic DNA-sensing pathway
    112260059
   04625 C-type lectin receptor signaling pathway
    112260059
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112260059
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112260059
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112260059
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112260059
Transcription factors [BR:otw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    112260059
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer PBP_N
Other DBs
NCBI-GeneID: 112260059
NCBI-ProteinID: XP_024290629
LinkDB
Position
10
AA seq 613 aa
MDGIYGWEQPPLNQGNPFIEIIEQPKQRGMRFRYKCEGRSAGSTPGEKSNDTTKTHPAIK
VHNYNGPLRVRVSLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRVHSFQNLGIQCVKK
KDVAEAVSCRLQTQNNPFNIPEANMWEEFDLNAVRLCFQASITLPTGELCPLEPVVSQPI
YDNRAPNTAELKICRVNRNSGSCIGGDEIFLLCDKVQKEDIEVRFFQGSWEGKGTFSQAD
VHRQVAIVFCTPPYCDTNLTEPIRVKMQLRRPSDREVSEPMDFQFLPSDPDEYRLMEKRK
RTEGMLQNLKLGSLMSGTMPAETRPFNIARRTVTAKPAASQPVMNPVVPPSAFSVKPQPY
YNGPQPGKLFQTQPKAEASSTAAETWKFLNSLTLDSQPKATPVASFTTNPQASAATAASS
QAFPTVNLLDFNGFAFHNFACPQEPVSAAPTPEPTSTFGVQGSQFKVDEELPEFPSFSEA
QAPGTLDSINIEEFQAMLGQSCLAEEGPKSSEASAPQAPCHLPSTNTVANNAAQNQADPA
NHHTGCGGSTWMNYPNSIVSLLQNEGMMDSSPGNASQPAALDDLDVLSSMDEDRLMSILN
SGNQYSFVPGHQT
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggatggaatttatggatgggaacagccccctttgaaccaaggtaatcccttcattgag
ataattgaacagcccaagcagaggggcatgaggttcaggtacaagtgtgaggggcgctct
gcgggaagcaccccgggagagaagagcaatgacaccaccaagacacaccccgccattaag
gtgcacaactacaatggccccctgcgtgtccgcgtctccttggtgaccaagaacccacct
cacaagccccacccccacgaactggtggggaaagactgcaaacatggttactatgaggca
gacctgcaggagagacgagtacacagttttcagaacctgggcattcagtgtgtgaagaaa
aaggatgtggccgaggcagtttcctgtaggctgcagacccaaaacaaccccttcaacatt
cctgaggcgaacatgtgggaggagtttgacctaaatgcagtgaggctgtgtttccaggcc
tcgatcactctgcctaccggggaactctgccctctggagcccgtggtgtcccagcccatc
tacgacaacagagcacccaacacagcagaactgaagatctgtcgagtgaacagaaactct
ggaagctgcatagggggggatgagatcttcttactttgtgacaaagtgcaaaaagaggac
atcgaggtgcggttcttccagggctcgtgggaggggaagggcaccttctcccaggcggac
gtacacaggcaggtggccattgtgttctgcaccccgccctactgcgacaccaacctgacc
gagccaatccgagtgaagatgcagctccgcaggccctcggatcgtgaggtcagcgagcca
atggacttccagttcctgccctcagacccagatgaatacagactgatggagaagagaaaa
cggacagagggaatgttacagaatctgaagctggggtccctgatgtcggggaccatgcca
gcagagacaaggccgttcaacattgccaggagaacagtcaccgccaagccagcagctagc
cagcctgtgatgaacccagtggtgccccctagtgccttctctgtgaagccccagccctac
tacaacggcccccagccaggcaagttgtttcaaacccagcccaaagcagaagcctcctcc
accgcagccgagacctggaagttcctcaacagcctgactctggactcccagcccaaagcc
acccccgtggccagcttcaccaccaacccccaggcctctgcagcgacagccgcctcctcc
caggcctttcccaccgtaaacctgttggacttcaacggattcgctttccacaactttgct
tgtccccaggagccggtgagtgcagcccctacaccagagcccacctctaccttcggggtc
caagggtcccagttcaaggtggatgaggagctacccgaattccccagcttttctgaggca
caagcgccagggactctagatagtataaacattgaagaattccaggctatgctgggccag
agttgtctggctgaagaagggccaaagagcagtgaggcgtcagcccctcaggcaccctgc
cacttaccctccaccaacactgtggccaacaacgcggcccagaaccaagcagacccagcc
aaccaccacaccggctgtggcggcagcacctggatgaactaccccaacagcattgtcagc
ctgctccagaacgagggcatgatggacagttcccccggcaatgccagccagccggccgcc
cttgacgacctggacgtcttaagctccatggacgaagaccgtctcatgtccatcctgaac
agtggcaaccaatacagttttgtgcccggacatcagacctaa

DBGET integrated database retrieval system